Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853071, TIF4631

Organisms

Yeast (4932)

Synonyms

YGR162W;
Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p

Description

Tif4631p

Xrefs

SGD:S000003394

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 853071 PMID: 16429126

Sequence Information

Nucleotide sequence

>853071 : length: 2859
atgacagacgaaactgctcacccgacacaatctgcttcaaagcaggaatctgctgctctg
aaacagacaggcgatgaccagcaggaatctcagcaacaacgtggctacaccaactacaac
aatggtagcaactatacccaaaagaagccttacaacagcaacagacctcatcagcaaaga
ggtggtaaatttggaccaaacagatataacaaccgtggcaactataatggtggcggtagt
ttcagaggtggacacatgggagccaacagctcaaacgtgccatggactggttactataat
aactaccccgtttactaccagccccagcaaatggcggccgctggtagtgcccctgctaat
ccaattcctgtcgaagagaagtcacctgttccaactaagatagaaatcactaccaagtct
ggtgaacacttagatttgaaagaacagcataaagccaagctacagtctcaggaaagatct
actgtgtctccgcaaccagagtcaaagttaaaagaaacttctgattctacttctacttct
actccaactcctaccccttccactaatgactctaaggccagttctgaagaaaatatatct
gaagctgaaaagacaagaagaaatttcatcgagcaagttaaacttcgtaaagctgcttta
gaaaagaagagaaaggagcaacttgaaggttctagtggcaacaataatattccaatgaag
actaccccagaaaatgtggaagagaagggatcggacaaacctgaggtaaccgaaaaaacc
aagcctgctgaagaaaaatctgctgagccagaagttaagcaagaaactccagctgaagaa
ggtgaacaaggagaaaagggccaaataaaggaagaatccactccaaaggtgttaaccttt
gctgaacgtttgaagttgaagaaacaacaaaaagaacgagaagaaaaaacggaggggaag
gaaaacaaggaagtgccagtacaggaagagactaagagcgccatcgagtctgctcctgtg
cctcccagtgaacaggttaaagaagaaactgaggtcgccgaaaccgaacagtcaaacatt
gatgaatctgcaacaactccggctatccctactaaatctgatgaagctgaagctgaagtt
gaggctgaagcaggtgatgctggaacaaagattggacttgaagctgaaatcgaaactaca
actgatgaaactgatgatggtacaaacaccgtttctcacatattgaatgtattgaaagat
gctacaccaattgaagatgtcttttcttttaactatccagaaggtattgaaggtcctgat
atcaaatacaagaaagaacacgtcaaatatacatatggcccaactttcttgcttcaattt
aaggacaaactaaacgtcaaagcggacgccgaatgggtccaaagcactgcttctaaaatt
gtcattccaccaggaatgggcagaggaaatagatctagagattctggcagattcggcaat
aattctagtcgtggccatgactttagaaatacctcagtgagaaatatggatgacagagct
aattcaagaacttcatcaaagagaagatcaaagagaatgaatgacgacaggagatctaat
agatcttatacatcaagaagagaccgcgagagaggctcctacagaaatgaagagaaaaga
gaggacgataaaccaaaggaagaagttgctccacttgttccaagtgctaataggtgggtg
ccaaaattcaagtctaaaaagactgaaaagaagctagcccctgacggaaagaccgaacta
ttggacaaggatgaagttgaaagaaagatgaagtcactactgaataaacttactttggaa
atgttcgatgctatttcatctgaaattttggctattgcaaacatatcagtatgggaaaca
aatggtgaaacgttaaaggctgtgatagaacagattttcttaaaggcctgtgacgaaccc
cattggtcttctatgtacgcgcaattatgtggtaaagtagttaaagaattaaacccagat
ataacagatgaaactaatgaaggtaagacaggtccaaaattggttttgcattacttggtt
gctagatgtcatgccgaatttgacaagggttggaccgataaattacccacaaacgaagat
ggtactccattagaacctgagatgatgtcagaagagtactatgcagctgcttctgctaag
agaagaggtttaggtttggttcgtttcatcggtttcctataccgtctgaatctgttgact
ggaaagatgatgttcgaatgtttccgtagactaatgaaggatttgacggattctccatct
gaagaaactctagagtccgttgttgaattgttaaatactgttggtgaacaatttgagacc
gatagtttcagaacgggtcaagcaacattggagggttcgcaattgctcgatagtttgttc
ggtattttagacaatattattcaaactgctaagatttctagtagaatcaagttcaagttg
atcgacattaaagaattaaggcacgacaagaactggaacagtgataagaaggacaacggt
cctaagaccattcaacagattcatgaggaagaggagagacaacgtcaattgaagaataat
tcaagatctaattcaagacgtacgaacaactccagtaatagacactctttcagaagggac
gctcctcctgcatcaaaagatagctttatcacaaccagaacatattctcaaagaaatagc
caaagggctcctcctccaaaggaagaaccagctgcaccaacttctaccgcaacaaatatg
ttcagtgcattaatgggagaaagtgatgacgaagagtaa

Protein sequence

>853071 : length: 952
MTDETAHPTQSASKQESAALKQTGDDQQESQQQRGYTNYNNGSNYTQKKPYNSNRPHQQR
GGKFGPNRYNNRGNYNGGGSFRGGHMGANSSNVPWTGYYNNYPVYYQPQQMAAAGSAPAN
PIPVEEKSPVPTKIEITTKSGEHLDLKEQHKAKLQSQERSTVSPQPESKLKETSDSTSTS
TPTPTPSTNDSKASSEENISEAEKTRRNFIEQVKLRKAALEKKRKEQLEGSSGNNNIPMK
TTPENVEEKGSDKPEVTEKTKPAEEKSAEPEVKQETPAEEGEQGEKGQIKEESTPKVLTF
AERLKLKKQQKEREEKTEGKENKEVPVQEETKSAIESAPVPPSEQVKEETEVAETEQSNI
DESATTPAIPTKSDEAEAEVEAEAGDAGTKIGLEAEIETTTDETDDGTNTVSHILNVLKD
ATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKI
VIPPGMGRGNRSRDSGRFGNNSSRGHDFRNTSVRNMDDRANSRTSSKRRSKRMNDDRRSN
RSYTSRRDRERGSYRNEEKREDDKPKEEVAPLVPSANRWVPKFKSKKTEKKLAPDGKTEL
LDKDEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEP
HWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKLPTNED
GTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPS
EETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKL
IDIKELRHDKNWNSDKKDNGPKTIQQIHEEEERQRQLKNNSRSNSRRTNNSSNRHSFRRD
APPASKDSFITTRTYSQRNSQRAPPPKEEPAAPTSTATNMFSALMGESDDEE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min