Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853128, RPS0A

Organisms

Yeast (4932)

Synonyms

YGR214W;
NAB1|YST1;
Rps0ap

Description

Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Bp; required for maturation of 18S rRNA along with Rps0Bp; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal

Xrefs

SGD:S000003446

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 853128 PMID: 16429126

Sequence Information

Nucleotide sequence

>853128 : length: 759
atgtccttaccagctacttttgacttgactccagaagatgcccaacttttgttggctgct
aacactcacttaggtgctagaaacgttcaagttcaccaagaaccatatgttttcaacgca
agaccagatggtgtccacgttatcaacgttggtaagacctgggaaaaattggttttggct
gccagaatcatcgctgccattccaaacccagaagacgttgttgccatctcttccagaact
ttcggtcaaagggctgttttgaagttcgctgcccacaccggtgctaccccaatcgccggt
agattcactccaggttctttcaccaattatatcacccgttctttcaaggaaccaagatta
gttattgtcaccgacccaagatcagatgctcaagccatcaaggaagcttcttacgttaac
atccctgtcattgctctaactgatcttgactctccatcagaattcgtcgatgtcgctatc
ccatgtaacaacagaggtaagcactccattggtttaatctggtacttattggctagagaa
gttttgagactaagaggtgctttagttgacagaactcaaccatggtccatcatgccagat
ttgtacttctacagagaccctgaagaagttgaacaacaagttgctgaagaagctaccacc
gaagaagctggtgaagaagaagccaaggaagaggttaccgaagagcaagctgaagctact
gaatgggctgaagaaaatgctgacaacgtcgagtggtaa

Protein sequence

>853128 : length: 252
MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLA
ARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRL
VIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLARE
VLRLRGALVDRTQPWSIMPDLYFYRDPEEVEQQVAEEATTEEAGEEEAKEEVTEEQAEAT
EWAEENADNVEW



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min