Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853152, YGR237C

Organisms

Yeast (4932)

Synonyms

YGR237C;
Ygr237cp

Description

Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm

Xrefs

SGD:S000003469

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 853152 PMID: 16554755
851152 853152 PMID: 16554755

Sequence Information

Nucleotide sequence

>853152 : length: 2358
atgtcatctgcaaagacatttactaagcatatctcgtttgatgatctggcaccttcctta
attgatgaccaagctaccattattaaaaatgacagtcaccatgttggcttgaataatcat
tttttacatatacctccacaatttaatcctgtttacaaaaatactttgaccggtagccat
ggctctaatgaccttgccactgacgaaagcttggactcacccgaagacgaagaagcttct
tcgccactacaactaggaactccaacgtctacaacatctggagttcctcacttctatact
caggtattttctcctgcagcacatgatccctccaaaagctatttgagatcgcccagcgtt
gaaagaagtagaagtgagtctccaatgttcaggtcaagaagaaggacttcagtgaggttg
cctccccctccaaaagtatccgtgctaaaaaaatctcgaaaagctgctgatgaacagggc
cctattgatgatattgatattggtgatttggattttgagctggaaagaaaaatgaccaaa
atgaccgaaagaaacactcaaaaaaattctggatcaaggaaaggctatacgcaagctgca
tttgccaatcttaatgaagttgaagatagaattgagaccaagtcaatggtagatttatcc
gaaagcgaaaatatggagagctcaaagaaaaggtccaagtcgtttgccgggatgacagac
gaagaattagccaaattagaggaattttatataagtaaaggaagatcgaacaagactaaa
atagatcaatttgattttggtgagcaagttccagtctatttgaacacaacagagtcaaaa
acggattcaagcaacgtgacggaccctttagcagcaatttatccatcaaggcctacaatt
gttcacaatgcaatttcaatgacaattgatcatccagactatgaaaattatatttccaat
acaaaagaaaagctcaattgcaaagacaaagatgacgatgtagatttaagagttgtttcg
tgttatatatcaggtaggagatatacttggtcatctgtggactggtatgttgaaaatttg
acaagaaatggtgatcatttagtcataattactacaattcctgagtttgaagcaaagatt
gatactctagcatataaggagaaaagaaggcaccgcttagaaaggatgactagcaatact
agtgaaagcatgactaccgcgtcacatagccttataggcccggatctctctagtccttta
tcaacgggaataagaatagaagctattcataatgaggctaagcaaacttgtagcgatatt
ttaaattactacgcgagaagattggcaactaaaatagttaggattagtattgagatggta
aaagaaaattcaacaagatcagccataatatctgcgacctctctgtataggccaagtttg
caagtaatcagcaccgttagtgccaacattcaaatcaagtttagaaatggaaaagtgaaa
ctaccattttttttaatgaaacactttgcaatgccagcatttgttgtcccattcgaattc
atcaagcctgagcttttaataaaacctagagtggataaagatgaacaggacaacagcgat
gatttgaaaacggaagtgagaaaaaaggaacgattgcaatggctaagtgcattaatcagg
agaactttggaaaaccctttcacaaaacataaagtggttgattcggatgatgaagaaagc
gatagtgatgagtcagtaacctctgtaaatgagtacttcccaatctcacctgaaaaaaag
gaagaaatggaattcttcgataagatgggatatgttagaccaaaaccgtcgagacaagta
ctattggatgataacactcttatgaagtacgacagttctggccgaaagctaactcctata
gaatcgagaaattcgaggcgcagctcaaagcggagttcaagaatacaattcaacaataac
ggcatttataaagtaaagtccatggttgatgacatttacaaccacgaaactgcctctacg
cctcatatcaagacagcactaaaatgggacaatgaggatccgaaaatgaagttcacttca
catccaatgagaaaaacaaaatccgcagggctatcacccagaacatcctccacttcatct
tcttcaggacagagaaaagcgcatcaccaccaccatcaccacaaccacgtttcaaggacg
aaaactaccgaaagcaccaaatcaggcaacagcaaaaaggacagttcctcatcctcaaca
aacgaccatcaatttaaaaggtctgaaaagaagaaaaaaagtaaatttggctcgatcttc
aaaaaagttttcggatga

Protein sequence

>853152 : length: 785
MSSAKTFTKHISFDDLAPSLIDDQATIIKNDSHHVGLNNHFLHIPPQFNPVYKNTLTGSH
GSNDLATDESLDSPEDEEASSPLQLGTPTSTTSGVPHFYTQVFSPAAHDPSKSYLRSPSV
ERSRSESPMFRSRRRTSVRLPPPPKVSVLKKSRKAADEQGPIDDIDIGDLDFELERKMTK
MTERNTQKNSGSRKGYTQAAFANLNEVEDRIETKSMVDLSESENMESSKKRSKSFAGMTD
EELAKLEEFYISKGRSNKTKIDQFDFGEQVPVYLNTTESKTDSSNVTDPLAAIYPSRPTI
VHNAISMTIDHPDYENYISNTKEKLNCKDKDDDVDLRVVSCYISGRRYTWSSVDWYVENL
TRNGDHLVIITTIPEFEAKIDTLAYKEKRRHRLERMTSNTSESMTTASHSLIGPDLSSPL
STGIRIEAIHNEAKQTCSDILNYYARRLATKIVRISIEMVKENSTRSAIISATSLYRPSL
QVISTVSANIQIKFRNGKVKLPFFLMKHFAMPAFVVPFEFIKPELLIKPRVDKDEQDNSD
DLKTEVRKKERLQWLSALIRRTLENPFTKHKVVDSDDEESDSDESVTSVNEYFPISPEKK
EEMEFFDKMGYVRPKPSRQVLLDDNTLMKYDSSGRKLTPIESRNSRRSSKRSSRIQFNNN
GIYKVKSMVDDIYNHETASTPHIKTALKWDNEDPKMKFTSHPMRKTKSAGLSPRTSSTSS
SSGQRKAHHHHHHHNHVSRTKTTESTKSGNSKKDSSSSSTNDHQFKRSEKKKKSKFGSIF
KKVFG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min