Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853178, BUD32

Organisms

Yeast (4932)

Synonyms

YGR262C;
LDB14;
Protein kinase proposed to be involved in bud-site selection, telomere uncapping and elongation, and transcription; component of the EKC/KEOPS protein complex with Kae1p, Cgi121p, Pcc1p, and Gon7p

Description

Bud32p

Xrefs

SGD:S000003494

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 853178 PMID: 14519092
856626 853178 PMID: 11805837
854948 853178 PMID: 14519092
854948 853178 PMID: 11805837

Sequence Information

Nucleotide sequence

>853178 : length: 786
atgacgcaagaattcattgataaagtatcttcctacctgactcctgatgtggacattgca
cctatttctcaaggtgcagaagccattgttttcacaacgactactcacccatatctccca
agagcaaaggattctcatcaaaagtatattatcaaatataggccaccaaagcgttataga
catccacaaatagaccaggcactaacaaaacatcgtacgttgaatgagtcgcgtttattg
gccaaattatacttgattccagggctatgtgtccctcaactgatagcgtgtgatccatac
aatggattcatttggttagagttccttggagaagatcttcccggagggcacggttttagt
aacctaaagaacttcctttggatgcatgaccaagatccatatagtgatcttgtagcaact
acactacggaaagtggggcgccaaattgggttgttgcactggaatgactactgtcatggt
gatttgacaagttctaacattgttctcgtgcgagatggtgcgagatggacgcctcatttg
attgatttcggtctgggctcagtttcaaacctggtcgaagataaaggcgtcgatttatac
gtcttagagagagctattttaagtacacattcgaagcatgcggaaaaatacaatgcttgg
atcatggaggggttcgaagaggtctatcgtgaacaaggtgcgaaaggtgccaagaaactg
aaagaagttaccaaaagattcgaagaggtcaggttgcgtggtcgtaagagaagtatgcta
ggataa

Protein sequence

>853178 : length: 261
MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYR
HPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFS
NLKNFLWMHDQDPYSDLVATTLRKVGRQIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHL
IDFGLGSVSNLVEDKGVDLYVLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKL
KEVTKRFEEVRLRGRKRSMLG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min