Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853344, GSH1

Organisms

Yeast (4932)

Synonyms

YJL101C;
Gsh1p

Description

Gamma glutamylcysteine synthetase catalyzes the first step in glutathione (GSH) biosynthesis; expression induced by oxidants, cadmium, and mercury

Xrefs

SGD:S000003637

Chromosome

X : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 853344 PMID: 16429126
854948 853344 PMID: 16429126

Sequence Information

Nucleotide sequence

>853344 : length: 2037
atgggactcttagctttgggcacgcctttgcagtggtttgagtctaggacgtacaatgaa
cacataagggatgaaggtatcgagcagttgttgtatattttccaagctgctggtaaaaga
gacaatgaccctcttttttggggagacgagcttgagtacatggttgtagattttgatgat
aaggagagaaattctatgctcgacgtttgccatgacaagatactcactgagcttaatatg
gaggattcgtccctttgtgaggctaacgatgtgagttttcaccctgagtatggccggtat
atgttagaggcaacaccagcttctccatatttgaattacgtgggtagttacgttgaggtt
aacatgcaaaaaagacgtgccattgcagaatataagctatctgaatatgcgagacaagat
agtaaaaataacttgcatgtgggctccaggtctgtccctttgacgctgactgtcttcccg
aggatgggatgccccgactttattaacattaaggatccgtggaatcataaaaatgccgct
tccaggtctctgtttttacccgatgaagtcattaacagacatgtcaggtttcctaacttg
acagcatccatcaggaccaggcgtggtgaaaaagtttgcatgaatgttcccatgtataaa
gatatagctactccagaaacggatgactccatctacgatcgagattggtttttaccagaa
gacaaagaggcgaaactggcttccaaaccgggtttcatttatatggattccatgggtttt
ggcatgggctgttcgtgcttacaagtgacctttcaggcacccaatatcaacaaggcacgt
tacctgtacgatgcattagtgaattttgcacctataatgctagccttctctgccgctgcg
cctgcttttaaaggttggctagccgaccaagatgttcgttggaatgtgatatctggtgcg
gtggacgaccgtactccgaaggaaagaggtgttgcgccattactacccaaatacaacaag
aacggatttggaggcattgccaaagacgtacaagataaagtccttgaaataccaaagtca
agatatagttcggttgatcttttcttgggtgggtcgaaatttttcaataggacttataac
gacacaaatgtacctattaatgaaaaagtattaggacgactactagagaatgataaggcg
ccactggactatgatcttgctaaacattttgcgcatctctacataagagatccagtatct
acattcgaagaactgttgaatcaggacaacaaaacgtcttcaaatcactttgaaaacatc
caaagtacaaattggcagacattacgttttaaaccccccacacaacaagcaaccccggac
aaaaaggattctcctggttggagagtggaattcagaccatttgaagtgcaactattagat
tttgagaacgctgcgtattccgtgctcatatacttgattgtcgatagcattttgaccttt
tccgataatattaacgcatatattcatatgtccaaagtatgggaaaatatgaagatagcc
catcacagagatgctatcctatttgaaaaatttcattggaaaaaatcatttcgcaacgac
accgatgtggaaactgaagattattctataagcgagattttccataatccagagaatggt
atatttcctcaatttgttacgccaatcctatgccaaaaagggtttgtaaccaaagattgg
aaagaattaaagcattcttccaaacacgagagactatactattatttaaagctaatttct
gatagagcaagcggtgaattgccaacaacagcaaaattctttagaaattttgtactacaa
catccagattacaaacatgattcaaaaatttcaaagtcgatcaattatgatttgctttct
acgtgtgatagacttacccatttagacgattcaaaaggtgaattgacatcctttttagga
gctgaaattgcagaatatgtaaaaaaaaataagccttcaatagaaagcaaatgttaa

Protein sequence

>853344 : length: 678
MGLLALGTPLQWFESRTYNEHIRDEGIEQLLYIFQAAGKRDNDPLFWGDELEYMVVDFDD
KERNSMLDVCHDKILTELNMEDSSLCEANDVSFHPEYGRYMLEATPASPYLNYVGSYVEV
NMQKRRAIAEYKLSEYARQDSKNNLHVGSRSVPLTLTVFPRMGCPDFINIKDPWNHKNAA
SRSLFLPDEVINRHVRFPNLTASIRTRRGEKVCMNVPMYKDIATPETDDSIYDRDWFLPE
DKEAKLASKPGFIYMDSMGFGMGCSCLQVTFQAPNINKARYLYDALVNFAPIMLAFSAAA
PAFKGWLADQDVRWNVISGAVDDRTPKERGVAPLLPKYNKNGFGGIAKDVQDKVLEIPKS
RYSSVDLFLGGSKFFNRTYNDTNVPINEKVLGRLLENDKAPLDYDLAKHFAHLYIRDPVS
TFEELLNQDNKTSSNHFENIQSTNWQTLRFKPPTQQATPDKKDSPGWRVEFRPFEVQLLD
FENAAYSVLIYLIVDSILTFSDNINAYIHMSKVWENMKIAHHRDAILFEKFHWKKSFRND
TDVETEDYSISEIFHNPENGIFPQFVTPILCQKGFVTKDWKELKHSSKHERLYYYLKLIS
DRASGELPTTAKFFRNFVLQHPDYKHDSKISKSINYDLLSTCDRLTHLDDSKGELTSFLG
AEIAEYVKKNKPSIESKC



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min