Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853397, MTR4

Organisms

Yeast (4932)

Synonyms

YJL050W;
DOB1;
Mtr4p

Description

Dead-box family ATP dependent helicase required for mRNA export from the nucleus; co-factor of the exosome complex, required for 3' end formation of 5.8S rRNA

Xrefs

SGD:S000003586

Chromosome

X : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851726 853397 PMID: 16554755
854681 853397 PMID: 16554755
851152 853397 PMID: 14759368

Sequence Information

Nucleotide sequence

>853397 : length: 3222
atggattctactgatctgttcgatgttttcgaggaaacacctgttgagcttcctacagat
agtaatggagaaaaaaatgctgatacaaacgtaggagatactccagatcatacccaggat
aagaagcatggccttgaagaagaaaaagaagagcatgaggaaaacaacagtgaaaataaa
aaaatcaaatccaataagagcaaaacggaagataaaaacaaaaaagttgtagtaccagtg
ttggcagattcgttcgaacaagaagcctctagagaagtggatgcatcgaaaggactgaca
aattcagaaaccttacaagttgagcaagacggtaaagtcagattatcgcatcaggtccgc
caccaggttgcactaccaccgaactatgattatacgcctatcgctgagcataagagggta
aatgaggctcgtacatatccattcacattagaccctttccaggacactgcaatctcatgt
atagatagaggcgaatctgtgttggtttctgcgcacacatcggctggtaaaacagttgtg
gctgaatatgccatcgcacaatctttaaaaaataagcaaagagtcatttatacctctcca
attaaggctctatcaaaccaaaaatacagagaacttttagcagaatttggagatgtcggt
ttgatgactggtgatatcacgatcaatccggatgcaggctgtttggtcatgaccactgag
attttgagaagtatgttatatagaggcagtgaagttatgagagaagttgcctgggtcatc
tttgatgaagtgcattacatgagggataaagaaagaggtgttgtgtgggaagaaacgatt
attttactgccagataaggtccgttacgtgtttttatcggccaccattccaaatgcaatg
gagtttgctgaatggatatgcaaaattcattctcagccatgtcatattgtctacacaaat
ttccgtccaactcctttacaacattacctgtttccagcccatggagatggtatttatctg
gtggttgacgaaaaaagtaccttcagagaggaaaatttccaaaaagcaatggcgtccata
agtaaccagataggtgatgatccaaattccactgattcaagaggtaaaaagggtcaaacc
tataaaggtggctccgctaagggtgacgcaaaaggtgacatttataagatagtgaaaatg
atttggaagaaaaagtacaatccagtgattgtattttcgttcagtaaacgtgattgtgaa
gaattagcattgaagatgtctaaattagattttaattctgatgatgaaaaggaggctttg
acgaagatttttaacaatgccattgcactattaccagagacagacagagagctaccccaa
attaaacacattttaccattattaagaagaggtatcggtattcatcattccggtttactg
cccattttgaaggaagtcattgaaattctgtttcaagagggatttttgaaggtgttgttt
gcaacagaaacattttcgattggattaaacatgcctgctaaaactgttgtctttacatcg
gtcagaaagtgggatggtcaacaattccgctgggtttcaggtggagaatatatacaaatg
tctggtcgtgcaggtcgtcgtggtttagatgatcgtggtattgttattatgatgattgat
gaaaaaatggaacctcaagttgctaaaggaatggttaagggccaagcagataggctagac
tcggcttttcacttaggatataatatgattttgaacttaatgagagttgaaggtatctct
ccggagtttatgttggagcattctttcttccaatttcaaaacgttatttcagtaccagtt
atggaaaagaaacttgctgaactgaaaaaagactttgatggcatcgaagtcgaagatgaa
gaaaatgttaaagaataccatgagattgagcaggctatcaaaggttaccgtgaagatgtt
cgtcaagttgtcacccatccggcaaacgccttaagtttcctacaaccaggcagattagtt
gaaatctctgtcaatggtaaggataactatggctggggtgctgttgtcgattttgctaaa
agaattaacaaacgcaacccaagtgctgtctatacagaccatgaatcctatattgtcaat
gtggtcgtcaataccatgtatatagactctccagtcaacttgttgaaacctttcaaccct
accttaccagaagggattcgcccagcggaagaaggtgaaaaaagcatatgtgctgttatt
cccataactttggattcaatcaagtcgattggtaatttgagactatatatgcccaaagat
attagagccagcggtcaaaaagaaactgttgggaagtctttaagggaggttaatcggagg
ttcccggatggtattcccgtgctggatcctgttaaaaacatgaagatcgaagatgaggac
tttttaaagctaatgaagaagattgacgttttaaacacaaagttatcctccaatccctta
accaattccatgagactagaagaactatatggtaaatatagtagaaaacacgatttacat
gaagatatgaaacaattgaaacgcaaaatttcagaatcacaagccgtaatccaactggac
gatcttcgtcgccgtaaaagagttttgcgccgtttaggattttgtactcctaatgacatt
attgaactgaaaggtagagttgcatgtgaaatatctagtggtgatgaactgttactaaca
gaattgatcttcaatggtaatttcaatgagttgaaaccggaacaagcagcagcattatta
tcatgctttgcattccaagaacgctgtaaagaagcgcctagattgaaaccagagcttgcc
gaacctttgaaggctatgagagaaattgcagcaaagatcgctaagataatgaaggattct
aaaattgaagttgtagaaaaggactacgttgaaagcttcagacatgaactaatggaagtt
gtttacgaatggtgtagaggagctacttttacgcaaatctgtaaaatgaccgacgtttac
gaaggttcgttgatcagaatgttcaagagattagaggaattggtgaaggagctggtagac
gtcgccaataccattggtaactcttcacttaaggagaagatggaagctgtcttgaaatta
attcatagagatatcgtatctgctggttctttgtatttatag

Protein sequence

>853397 : length: 1073
MDSTDLFDVFEETPVELPTDSNGEKNADTNVGDTPDHTQDKKHGLEEEKEEHEENNSENK
KIKSNKSKTEDKNKKVVVPVLADSFEQEASREVDASKGLTNSETLQVEQDGKVRLSHQVR
HQVALPPNYDYTPIAEHKRVNEARTYPFTLDPFQDTAISCIDRGESVLVSAHTSAGKTVV
AEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPDAGCLVMTTE
ILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSATIPNAM
EFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASI
SNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCE
ELALKMSKLDFNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLL
PILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQM
SGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGIS
PEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVEDEENVKEYHEIEQAIKGYREDV
RQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAKRINKRNPSAVYTDHESYIVN
VVVNTMYIDSPVNLLKPFNPTLPEGIRPAEEGEKSICAVIPITLDSIKSIGNLRLYMPKD
IRASGQKETVGKSLREVNRRFPDGIPVLDPVKNMKIEDEDFLKLMKKIDVLNTKLSSNPL
TNSMRLEELYGKYSRKHDLHEDMKQLKRKISESQAVIQLDDLRRRKRVLRRLGFCTPNDI
IELKGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCKEAPRLKPELA
EPLKAMREIAAKIAKIMKDSKIEVVEKDYVESFRHELMEVVYEWCRGATFTQICKMTDVY
EGSLIRMFKRLEELVKELVDVANTIGNSSLKEKMEAVLKLIHRDIVSAGSLYL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min