Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853419, HCA4

Organisms

Yeast (4932)

Synonyms

YJL033W;
DBP4|ECM24;
Putative nucleolar DEAD box RNA helicase; high-copy number suppression of a U14 snoRNA processing mutant suggests an involvement in 18S rRNA synthesis

Description

Hca4p

Xrefs

SGD:S000003570

Chromosome

X : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 853419 PMID: 16429126
851152 853419 PMID: 16429126

Sequence Information

Nucleotide sequence

>853419 : length: 2313
atggccaaaaaaaatagattgaacacaactcaaagaaagactttacgtcaaaaggaagat
gagtacatcgaaaacttgaaaaccaaaattgatgagtatgaccctaagataaccaaggcc
aagtttttcaaagatctccccattagcgatcccacattaaaaggtttaagagaatcatcc
tttataaaacttactgagatccaagccgattctattcccgtgtccctgcaaggtcatgat
gtattggcggccgcaaagacaggttccggtaagacattagcatttttagttccagtaatt
gaaaagctataccgcgaaaaatggaccgaattcgatgggttaggtgcccttatcatatct
ccaacaagagagttggctatgcaaatatatgaggttttgacgaaaataggtagtcacact
tcattttcagctgggttagttatcggtggtaaagatgttaaattcgaactagaaaggata
tcaaggattaacattcttatcggtacacctggtcgtattttacaacatttagatcaagcc
gtaggtctaaatacttccaatttgcagatgcttgttcttgacgaagctgatagatgttta
gacatggggtttaaaaaaactctggatgccatcgtaagcacattgtcaccatctagacaa
acacttttattttcagcgactcaatcacaatctgttgcagacttggctaggctttccttg
acagattataaaaccgttggtacacatgatgtgatggatgggtcggttaacaaagaagca
tctactccagaaactttgcaacaattctacattgaagttcctttggcagataaattggat
atccttttcagttttataaaatcacatttaaaatgcaaaatgatcgttttcttatcaagt
tccaaacaagtgcattttgtctatgagacatttaggaagatgcagcctggtatttcttta
atgcatttacacggtagacagaaacaacgtgctaggacagaaactttggacaaattcaat
cgtgctcaacaggtgtgtctttttgctaccgatgtcgttgctagaggtattgactttcct
gcagtcgattgggttgttcaagtggattgtccagaggacgttgatacatatatccacaga
gtcggtagatgtgctcgttacggtaaaaagggtaaatctttaatcatgttgactccacaa
gagcaggaagcgttcctaaaaagacttaacgctagaaagatcgaaccaggcaaacttaat
ataaaacagtcaaaaaagaaatccattaaaccacaattgcagtcattattattcaaggat
ccagaactaaaatatctaggacaaaaggcttttatatcgtacgtgagatctatatatgtg
caaaaggacaaacaagttttcaaattcgatgagttaccaacagaagaattcgcttattct
cttggtttaccaggggccccaaaaatcaaaatgaagggtatgaagaccattgagcaggcc
aaagaaagaaagaatgctccaagacagctagctttcttatcaaaagcaaatgaagatggt
gaagtaattgaagataagtcgaaacaaccaagaacaaaatatgataaaatgtttgaacgt
aaaaatcaaaccatcttaagtgaacactatttgaatataacgaaggctcaagcacaagaa
gacgaggatgacgatttcatttctgtcaagcgtaaagatcatgaaataaatgaagctgag
ttaccagctctaactcttccaacttcaaggcgagcacagaagaaagcgctttcaaagaag
gcatctctggcctccaagggtaacgctagcaaattaatatttgatgatgaaggcgaagcc
catccagtttatgaacttgaagatgaagaagaatttcataagagaggtgatgcggaggta
caaaagacagaatttttaactaaagaatctgcagtaatggcagacattgacaatattgat
aagcaggtggctaaagaaaaaaaacaagagaagaagagaaaaagactagaagccatgaga
agggaaatggaggctgctatggaagaagaaatttctggagatgaagaagaagggaagaca
gtagcatatttaggaacaggaaacttgagcgatgatatgagcgacggtgatatgcctgac
tcggaaggccacttgaaaaagaaagctagaactgttgactattcccacggccacaatcca
tccaattcagttgatgatgacattattgaagtggaagaaccacaaactttggaggatttg
gaatctttgacagctaaattaatccagggttaa

Protein sequence

>853419 : length: 770
MAKKNRLNTTQRKTLRQKEDEYIENLKTKIDEYDPKITKAKFFKDLPISDPTLKGLRESS
FIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKWTEFDGLGALIIS
PTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERISRINILIGTPGRILQHLDQA
VGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQSVADLARLSL
TDYKTVGTHDVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSS
SKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFP
AVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQEQEAFLKRLNARKIEPGKLN
IKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVRSIYVQKDKQVFKFDELPTEEFAYS
LGLPGAPKIKMKGMKTIEQAKERKNAPRQLAFLSKANEDGEVIEDKSKQPRTKYDKMFER
KNQTILSEHYLNITKAQAQEDEDDDFISVKRKDHEINEAELPALTLPTSRRAQKKALSKK
ASLASKGNASKLIFDDEGEAHPVYELEDEEEFHKRGDAEVQKTEFLTKESAVMADIDNID
KQVAKEKKQEKKRKRLEAMRREMEAAMEEEISGDEEEGKTVAYLGTGNLSDDMSDGDMPD
SEGHLKKKARTVDYSHGHNPSNSVDDDIIEVEEPQTLEDLESLTAKLIQG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min