Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853531, RFC2

Organisms

Yeast (4932)

Synonyms

YJR068W;
Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon

Description

Rfc2p

Xrefs

SGD:S000003829

Chromosome

X : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 853531 PMID: 16429126

Sequence Information

Nucleotide sequence

>853531 : length: 1062
atgtttgaagggtttggtccaaataaaaagcgtaagatatcaaagttagccgcagagcaa
tcattggcacaacaaccctgggttgagaaatacaggcccaaaaacctagatgaagtgaca
gctcaagatcatgccgttactgttttgaagaaaaccttaaagtcagctaatctaccacat
atgttgttttatggtcccccaggaactggtaaaacgtctaccattttagcgctaacaaaa
gaattatatggacccgacttgatgaaatcaagaatattggagttgaacgcttctgacgaa
cgtggtatctctattgtaagagaaaaggtaaaaaattttgcaagattgactgtatccaag
cctagcaaacatgacttggagaactatccgtgcccaccgtataagatcattattctcgat
gaggccgattcaatgactgccgatgcacagagtgcattacgtagaacaatggaaacctat
tcaggagtaacaagattctgtttgatttgtaattatgtgacaagaattattgacccgcta
gcgtcccgttgttccaaatttagattcaaagccctagacgcaagtaatgccattgaccgt
ttgaggtttatcagcgaacaagaaaatgttaaatgtgatgatggagttttggaaaggatc
ttggacatttcggcaggtgacttgagaagaggcattacattattacaatccgcttccaag
ggggcgcaatacttgggtgatggtaaaaacataacttctacccaagtggaagaattagct
ggtgtggtacctcatgacattctaatagaaattgttgaaaaagtcaaaagtggtgatttt
gatgagattaagaaatacgtcaatacgtttatgaaaagcggttggtctgctgcgtcagta
gttaaccaactacatgaatattacatcaccaacgataactttgatacgaacttcaaaaat
caaatatcttggttgctgtttactacggattccagattaaacaacggaacgaacgagcac
atccaattattaaacttattggttaaaatatcccaactctaa

Protein sequence

>853531 : length: 353
MFEGFGPNKKRKISKLAAEQSLAQQPWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPH
MLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSK
PSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPL
ASRCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASK
GAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASV
VNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min