Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853610, RPS4A

Organisms

Yeast (4932)

Synonyms

YJR145C;
Rps4ap

Description

Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein

Xrefs

SGD:S000003906

Chromosome

X : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 853610 PMID: 16429126
854948 853610 PMID: 17200106
851152 853610 PMID: 16429126

Sequence Information

Nucleotide sequence

>853610 : length: 786
atggctagaggaccaaagaagcatctaaaaagattagcagctccacaccactggttattg
gacaagttgtccggttgttacgccccaagaccatctgctggtccacacaaattgcgtgaa
tccttgccattgattgtctttctaagaaacagattaaagtatgctttgaacggccgtgaa
gtcaaggctatcttgatgcaacgtcacgttaaagtggacggtaaggttagaaccgacact
acctacccagctggtttcatggatgtcatcactctagatgccaccaatgaaaacttcaga
ttggtctacgatgtcaagggtagattcgctgtccaccgtatcaccgatgaagaagcttct
tacaagttgggtaaggtcaagaaggttcaattaggtaagaagggtgttccatacgttgtt
acccacgatggtagaactatcagatacccagacccaaacatcaaggtcaatgacactgtt
aagatcgacttggcctctggtaagattactgatttcatcaagttcgatgccggtaagttg
gtttacgttactggtggtcgtaacttgggtcgtatcggtactatcgttcacaaggaaaga
cacgatggtggtttcgatttagttcacatcaaggactccttggacaacactttcgtcact
agattgaacaatgtcttcgtcatcggtgaacaaggtaagccttacatttctttgccaaag
ggtaagggtatcaagttgtctattgctgaagaacgtgacagaagaagagctcaacaaggt
ttataa

Protein sequence

>853610 : length: 261
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min