Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853668, SAC1

Organisms

Yeast (4932)

Synonyms

YKL212W;
RSD1;
Sac1p

Description

Phosphatidylinositol (PI) phosphatase, involved in hydrolysis of PI 3-phosphate, PI 4-phosphate and PI 3,5-bisphosphate to PI; membrane protein localizes to ER and Golgi; involved in protein trafficking, secretion and inositol metabolism

Xrefs

SGD:S000001695

Chromosome

XI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 853668 PMID: 16554755

Sequence Information

Nucleotide sequence

>853668 : length: 1872
atgacaggtccaatagtgtacgttcaaaatgcggacggtatcttcttcaagcttgctgag
ggcaaaggaactaacgatgctgttattcacttggccaatcaagatcaaggtgttcgggtc
cttggagcagaggaatttcctgtgcaaggtgaagtagtaaagattgcgtccttgatgggg
ttcattaagctaaagttgaacaggtatgccattatcgcaaatactgtggaagagaccggt
agattcaatggccacgttttctatagagtgttgcaacattctatcgtatctaccaagttt
aactcgagaatcgattctgaagaagccgaatatatcaagctactggagttgcatttgaaa
aattccaccttttatttttcatacacatatgatttaacaaattccttacaaagaaatgaa
aaggttggtcctgcagcctcctggaaaaccgctgatgaacgattcttttggaaccattac
ttaactgaagatttgagaaactttgctcatcaagatcctagaattgactcctttatacaa
cctgttatctatgggtatgccaagacagtggacgccgttttgaatgccacccctatcgtt
cttggtttgattaccagacgtagtatatttagggcgggcacaagatacttccgtcgtggt
gttgacaaagacggtaacgttggcaatttcaatgaaactgagcaaattttactcgctgag
aatccagagagtgaaaaaatacacgttttctccttcttacagacaagaggatctgtgcca
atatactgggctgaaatcaacaacttgaagtacaagccaaatcttgttcttggagaaaac
tcattagatgcgacaaaaaagcattttgaccagcaaaaggagttatatggcgacaactac
ttggttaacctagtcaaccaaaagggccacgaactacccgtgaaagagggctatgaatca
gtcgtgcacgcgctaaacgatccgaagattcactacgtgtattttgacttccaccatgaa
tgtcgtaagatgcaatggcatagagtgaaattgttaattgatcacctggagaaattaggt
ttatctaacgaagatttcttccacaaggtcatagactctaatggtaacaccgttgaaatt
gttaatgagcaacattccgttgtaagaacaaactgtatggattgtttggacagaacaaat
gtcgttcaatctgttttagcccagtgggttttgcaaaaggagtttgaaagtgccgatgtc
gttgctactggaagcacttgggaagacaacgctccattgttaacttcttaccaaaactta
tgggctgataatgcagatgcagttagtgtggcatattcgggcactggagctttgaagacc
gatttcacaagaaccggtaagcgtacacgtctaggtgcattcaacgattttttgaattca
gcatcacgttattaccagaacaattggactgatggtccaagacaggattcatacgattta
ttccttggtggatttagaccacataccgcttctatcaagtcgccattccccgacagaaga
ccagtgtatattcagctgatcccaatgatcatttgcgcagccttgaccgttttaggtgct
acgatattttttcctaaagatagatttaccagcagtaagaatttgctgtattttgcaggt
gcgtcgattgtcttggcgctttcaaccaaattcatgtttaagaacggtattcagtttgtc
aactggcctaagttagtagacgttgggttcttggtcgttcatcaaacgcatgataaagaa
caacaattcaaaggtttgaaatatgcacagagtcctaaattttccaagccggatccttta
aaaagagattaa

Protein sequence

>853668 : length: 623
MTGPIVYVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQGEVVKIASLMG
FIKLKLNRYAIIANTVEETGRFNGHVFYRVLQHSIVSTKFNSRIDSEEAEYIKLLELHLK
NSTFYFSYTYDLTNSLQRNEKVGPAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQ
PVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAE
NPESEKIHVFSFLQTRGSVPIYWAEINNLKYKPNLVLGENSLDATKKHFDQQKELYGDNY
LVNLVNQKGHELPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVKLLIDHLEKLG
LSNEDFFHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESADV
VATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFTRTGKRTRLGAFNDFLNS
ASRYYQNNWTDGPRQDSYDLFLGGFRPHTASIKSPFPDRRPVYIQLIPMIICAALTVLGA
TIFFPKDRFTSSKNLLYFAGASIVLALSTKFMFKNGIQFVNWPKLVDVGFLVVHQTHDKE
QQFKGLKYAQSPKFSKPDPLKRD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min