Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853718, CTK1

Organisms

Yeast (4932)

Synonyms

YKL139W;
Ctk1p

Description

Catalytic (alpha) subunit of C-terminal domain kinase I (CTDK-I), which phosphorylates the C-terminal repeated domain of the RNA polymerase II large subunit (Rpo21p) to affect both transcription and pre-mRNA 3' end processing

Xrefs

SGD:S000001622

Chromosome

XI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 853718 PMID: 14769921

Sequence Information

Nucleotide sequence

>853718 : length: 1587
atgtcctacaataatggcaatacttattcaaagagttatagcagaaataataagagaccc
ttgttcggaaagaggtcgccaaatcctcagtccctagcgagaccaccgccaccaaagaga
atacggactgatagtggttaccagtcgaatatggacaatatatcttctcatagggtaaat
tcaaatgaccaaccaggccacacgaaaagtcgtggtaacaataatttatctcgctataac
gatacatcctttcaaacaagttccagatatcaaggttcaagatacaacaataataatacg
tcgtatgaaaataggcctaaaagcataaaaagggatgaaacaaaggctgaattcctgtct
catttgccaaaggggcccaaatctgttgagaaatcaagatataataattcatccaatact
agtaatgatataaaaaatggctatcatgcttcaaaatactataaccacaaaggccaggaa
gggcggtctgtcatagctaagaaagttccagtttcggttctaacgcagcaaaggagcacg
tcagtttacctaaggataatgcaagtcggagaaggaacatatggtaaagtttacaaggca
aaaaacacgaatacagagaagttagtagcgctgaaaaaattgagattacaaggagagagg
gaaggctttcccataacctctatacgagagattaaactactacaaagttttgatcatcca
aatgtctctactataaaagaaataatggtcgaatctcaaaaaactgtatatatgatattt
gaatatgctgacaacgacttaagtggattactattaaataaggaagtccaaatttctcac
tcacaatgcaaacatctcttcaaacaattgctattaggaatggaatatttacatgataat
aagattttacaccgtgatgttaaaggctcaaacatcttaatcgataaccaggggaatcta
aaaataacagattttggactagcgaggaaaatgaattcgcgagctgattacactaaccgt
gtcattacgttgtggtacagaccaccagaactattgttgggaactacaaattatggaaca
gaagttgacatgtggggttgtggctgcctcctggtggaattattcaataaaactgcaatt
ttccagggctctaatgaattagagcaaatagaatcaattttcaagattatgggaactcct
acaataaatagctggccaacgctttacgatatgccgtggttttttatgattatgccacag
caaactaccaagtatgtcaacaatttttctgagaaatttaaaagcgttttaccatcttca
aaatgtctgcaattggcgattaatttgttatgttatgatcagacgaaaaggtttagtgca
accgaagctttacaaagcgactatttcaaggaagaaccaaagcctgaacctttagttctt
gatggattggtaagttgccacgaatatgaagtcaaattggcaagaaaacaaaagcgtcct
aacatactatccaccaacacaaacaataagggtaatggtaatagtaataataataataat
aataataatgacgatgatgataaataa

Protein sequence

>853718 : length: 528
MSYNNGNTYSKSYSRNNKRPLFGKRSPNPQSLARPPPPKRIRTDSGYQSNMDNISSHRVN
SNDQPGHTKSRGNNNLSRYNDTSFQTSSRYQGSRYNNNNTSYENRPKSIKRDETKAEFLS
HLPKGPKSVEKSRYNNSSNTSNDIKNGYHASKYYNHKGQEGRSVIAKKVPVSVLTQQRST
SVYLRIMQVGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQSFDHP
NVSTIKEIMVESQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDN
KILHRDVKGSNILIDNQGNLKITDFGLARKMNSRADYTNRVITLWYRPPELLLGTTNYGT
EVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPTINSWPTLYDMPWFFMIMPQ
QTTKYVNNFSEKFKSVLPSSKCLQLAINLLCYDQTKRFSATEALQSDYFKEEPKPEPLVL
DGLVSCHEYEVKLARKQKRPNILSTNTNNKGNGNSNNNNNNNNDDDDK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min