Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

853896, GCN3

Organisms

Yeast (4932)

Synonyms

YKR026C;
AAS2;
Gcn3p

Description

Alpha subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a positive regulator of GCN4 expression

Xrefs

SGD:S000001734

Chromosome

XI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 853896 PMID: 10688190

Sequence Information

Nucleotide sequence

>853896 : length: 918
atgtcggagtttaatattacagaaacttatctaaggtttttagaagaagatactgagatg
acaatgccgattgctgccattgaagcattggtcacgctattaagaataaaaacaccagaa
acagcggcagaaatgattaatacaataaaaagctccacggaagaacttattaaatccatt
ccgaactcagtttccctgagagccggttgtgatattttcatgagatttgtcttaagaaat
cttcatttatacggtgattgggaaaactgtaaacaacatttgattgaaaatggccagctt
tttgtatcgagagccaaaaaatcgcgtaacaagattgcagaaataggggtggatttcata
gctgatgatgatatcatcttggtacatggttattcgagagcagtattttctttattaaat
catgcagcaaataagtttattaggttcagatgtgtggtgacagaatcaagacctagcaaa
caagggaaccagctatatactttacttgaacaaaagggcatacccgtgactcttattgtc
gatagcgcggttggagcggtaatcgataaggttgacaaagtgttcgttggtgctgagggt
gttgctgaatcaggtggtattataaatctcgtgggtacctattcagtgggtgttttagca
cataatgcaagaaaaccattctatgtggtcactgaaagtcacaaatttgttcgtatgttt
ccattgtcttcagatgatctacctatggccggccctcctttggatttcacacgtcgtacg
gacgatctagaagatgcattgcgtgggcccacgatcgactataccgcccaagaatacatt
actgcattgattacagatttaggggtcctcactccaagtgccgtttcagaagagttaatc
aagatgtggtatgattaa

Protein sequence

>853896 : length: 305
MSEFNITETYLRFLEEDTEMTMPIAAIEALVTLLRIKTPETAAEMINTIKSSTEELIKSI
PNSVSLRAGCDIFMRFVLRNLHLYGDWENCKQHLIENGQLFVSRAKKSRNKIAEIGVDFI
ADDDIILVHGYSRAVFSLLNHAANKFIRFRCVVTESRPSKQGNQLYTLLEQKGIPVTLIV
DSAVGAVIDKVDKVFVGAEGVAESGGIINLVGTYSVGVLAHNARKPFYVVTESHKFVRMF
PLSSDDLPMAGPPLDFTRRTDDLEDALRGPTIDYTAQEYITALITDLGVLTPSAVSEELI
KMWYD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min