Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854026, CDC33

Organisms

Yeast (4932)

Synonyms

YOL139C;
TIF45;
Cytoplasmic mRNA cap binding protein; the eIF4E-cap complex is responsible for mediating cap-dependent mRNA translation via interactions with the translation initiation factor eIF4G (Tif4631p or Tif4632p)

Description

Cdc33p

Xrefs

SGD:S000005499

Chromosome

XV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

853427 854026 PMID: 10585489
854948 854026 PMID: 16429126
854948 854026 PMID: 17200106
851152 854026 PMID: 16429126

Sequence Information

Nucleotide sequence

>854026 : length: 642
atgtccgttgaagaagttagcaagaagtttgaagaaaacgtttcagtcgatgataccaca
gctactccaaagactgttttaagtgacagtgctcacttcgatgtcaagcacccattgaac
accaaatggactttatggtacacaaagccagccgtcgataaatctgagtcgtggtctgat
ctattacgtcccgtcacttcattccaaactgttgaagaattttgggctatcattcaaaat
attcctgagccacacgaactaccattgaaatcagattaccacgtcttccgtaatgacgtt
agacctgaatgggaagatgaagccaatgctaaaggtggtaaatggtctttccaacttaga
ggaaaaggtgctgatattgatgaattatggctaagaactttactagcagttattggtgaa
acaattgatgaagacgactcccaaattaacggtgtcgttttaagcattagaaaaggtggt
aacaagtttgccttatggactaaatctgaagacaaagaaccactattgagaattggtggt
aaattcaagcaagttttaaaattaaccgatgacgggcatttggaattctttccacattcc
agtgccaatggtagacaccctcaaccatcaatcaccttgtaa

Protein sequence

>854026 : length: 213
MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSD
LLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLR
GKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGG
KFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min