Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854034, PAP2

Organisms

Yeast (4932)

Synonyms

YOL115W;
TRF4;
Pap2p

Description

Catalytic subunit of TRAMP (Trf4/Pap2p-Mtr4p-Air1p/2p), a nuclear poly (A) polymerase complex involved in RNA quality control; catalyzes polyadenylation of unmodified tRNAs, and snoRNA and rRNA precursors; disputed role as a DNA polymerase

Xrefs

SGD:S000005475

Chromosome

XV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 854034 PMID: 11805837
851152 854034 PMID: 11805837

Sequence Information

Nucleotide sequence

>854034 : length: 1755
atgggggcaaagagtgtaacagcctcttcttcaaagaagattaaaaaccggcataatggg
aaagtgaaaaagagcaagaaaatcaagaaagtacggaaaccacagaagtctatatccttg
aacgacgaaaacgaagtagagattttacctagtcgtaatgagcaagagacaaataaatta
cctaaagatcacgtcacggcggatggaattcttgtattagaacataaatctgatgatgat
gaaggattcgatgtctacgatggacatttcgataaccctactgatattccctcgactact
gaagaaagtaaaacgccttcattagcagtgcacggggatgagaaggatcttgctaacaat
gatgattttatctctctttctgctagttctgaggatgagcaagccgaacaggaagaggag
agggagaaacaagaattagaaattaaaaaagaaaagcaaaaggaaatccttaatactgat
tatccatggattttaaatcatgatcactccaaacagaaagaaatctcggactggctaacc
tttgaaatcaaggattttgttgcctatatctcaccaagtcgtgaagaaattgaaattcgt
aatcaaaccataagtacaataagagaggctgtcaaacagttatggccagatgctgatttg
cacgtgtttggatcatattctaccgatttgtatttgcctggttccgatattgattgcgtg
gtaacgagcgaacttggtggtaaggaaagtaggaataacttgtattcgttagcaagccat
ttaaaaaaaaaaaatttggcaacagaggttgaagttgtcgccaaagctcgcgttccaatc
atcaagtttgttgagccacattcagggatccacatagatgtttcatttgagagaacaaat
ggtattgaagcagcaaagcttattagagagtggttggacgatacccccggcctgagagaa
ttagtccttatcgtaaaacaattcctacacgcaagaagactaaataatgtgcataccggt
ggtcttggtgggtttagtattatatgtcttgtcttttcctttttgcatatgcacccacgt
ataataactaacgaaatagatccaaaggacaacttgggtgtgctcctgatagagtttttt
gaactttatgggaaaaattttggttatgatgatgttgcactgggatcatcggatggatat
ccagtatactttccaaaatcgacatggagtgctattcagcctattaaaaatccattttca
ttggccattcaagatccaggtgatgaatcaaataacatcagtcgagggtcctttaacatt
cgagatattaaaaaggcatttgctggtgcttttgatctgttgacgaatagatgttttgaa
ttacattcagcaacttttaaggatcgattggggaaaagtatattgggaaacgtgatcaaa
tatcgtggaaaggcaagagatttcaaggatgaaagaggtctagtactgaataaggctatt
attgaaaatgaaaactatcacaagaaacgtagcagaataattcatgatgaagattttgcc
gaagatacagttacctccacagccaccgctaccacaacagatgatgattatgaaataacg
aacccacctgctaagaaggctaaaatagaagaaaaacctgaaagtgaaccggccaagaga
aatagtggagagacatatatcactgtctctagcgaagatgatgatgaagatggatataat
ccttataccctttaa

Protein sequence

>854034 : length: 584
MGAKSVTASSSKKIKNRHNGKVKKSKKIKKVRKPQKSISLNDENEVEILPSRNEQETNKL
PKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPSTTEESKTPSLAVHGDEKDLANN
DDFISLSASSEDEQAEQEEEREKQELEIKKEKQKEILNTDYPWILNHDHSKQKEISDWLT
FEIKDFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCV
VTSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTN
GIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHMHPR
IITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFS
LAIQDPGDESNNISRGSFNIRDIKKAFAGAFDLLTNRCFELHSATFKDRLGKSILGNVIK
YRGKARDFKDERGLVLNKAIIENENYHKKRSRIIHDEDFAEDTVTSTATATTTDDDYEIT
NPPAKKAKIEEKPESEPAKRNSGETYITVSSEDDDEDGYNPYTL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min