Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854392, RFC1

Organisms

Yeast (4932)

Synonyms

YOR217W;
CDC44;
Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon

Description

Rfc1p

Xrefs

SGD:S000005743

Chromosome

XV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 854392 PMID: 16429126

Sequence Information

Nucleotide sequence

>854392 : length: 2586
atggtcaatatttctgatttctttggtaaaaataagaaatccgtaagatcgtcaacatcc
agacctacgagacaggtgggttcgtctaaaccagaagttatcgacttagatactgaatct
gaccaagaatcaaccaataaaacaccaaagaagatgcctgtaagtaatgtaattgatgta
tcagagacacctgaaggagaaaaaaagctacctcttcccgctaagaggaaggcctcttca
ccaactgtaaagccagcaagttcaaaaaaaaccaaaccctcctctaaaagttcagactcg
gcttcgaatattacggctcaagatgtactagataagattccatccttggatctgtcaaat
gttcatgtgaaagagaatgctaaatttgatttcaaaagcgcaaattcaaatgcggatcca
gatgaaattgtttctgaaataggtagttttccagaaggaaagccaaattgtttattaggt
ctaacaattgtcttcacaggtgttctgccaaccttggagcgtggtgcatcggaagcttta
gcgaaaagatacggagcaagggttactaaatcaatttcaagcaaaacttctgtagtagtc
ttaggtgatgaagcagggccaaagaaactagaaaaaatcaagcaattgaaaatcaaagcc
atagacgaagaaggctttaagcaattaattgctgggatgcctgctgaaggtggtgacggg
gaagctgccgaaaaagcacgtcgaaaattagaagaacagcataatattgctaccaaagaa
gcagaattgcttgttaagaaagaagaggaaaggtcgaagaagcttgcagccactagagtt
tctggtggccatctggagagagacaatgtggttagggaagaagataaattgtggacagta
aagtacgcaccaacgaatctacaacaggtctgtggtaacaaaggaagtgtaatgaaatta
aaaaactggttggctaattgggaaaattcaaagaaaaatagttttaaacatgctggtaaa
gatggctctggtgttttcagggctgcaatgttatacggtcctcctggtattgggaagaca
actgctgctcatttagttgcacaagagcttgggtatgacattcttgaacaaaacgcttct
gatgttcgctctaaaactttacttaatgccggtgttaaaaacgctcttgataacatgtct
gtagtgggatatttcaaacacaacgaagaagctcaaaatttgaacgggaaacattttgtc
attatcatggatgaagttgatggtatgagcggaggcgatagggggggagttggccagctg
gcacagttttgtcgtaagacgtcaactccattgattctaatttgtaatgaacgtaattta
ccaaaaatgagaccattcgatagagtatgtcttgatatccaatttagaagacctgatgct
aacagtatcaaatcaagattaatgacaattgcgatcagagaaaagttcaaacttgatcca
aatgtcattgataggttgatacagactacaagaggtgatatccgccaggttattaatcta
ctttcaacgatatctacgactactaaaaccataaaccatgaaaatatcaacgagatctca
aaggcatgggaaaagaatattgccctaaaaccctttgacattgcccataaaatgttggat
ggacaaatatactcagacataggttcaaggaactttacactgaatgataagatcgcatta
tattttgatgactttgatttcacacccctaatgattcaggaaaactatttatctacaaga
ccaagcgttttgaaacccggccagtcacatttggaagcagttgctgaggcggctaactgt
atttcattaggtgatattgtcgaaaagaagattcgtagtagtgagcaattatggagtctt
ttgcctttgcatgctgttctttcatctgtttatccagcatcaaaagttgccggccatatg
gcgggaagaatcaatttcacagcttggttgggccaaaattctaaatctgccaaatattat
aggttactgcaagagatacattatcatacaagactaggtacatctactgataaaattgga
ctaaggctggattacctaccaacttttagaaaaagattattggacccatttttgaagcaa
ggtgctgatgcaatttcatctgtcatagaggtaatggacgattactatttgaccaaagaa
gactgggattctattatggagtttttcgtaggtcctgatgtgaccacagccattatcaaa
aagataccagctacggttaaaagtggattcacgcggaaatacaacagtatgacacatcca
gtcgcaatttacagaacaggtagtactattggtggtggtggtgttggcaccagtactagc
acccccgatttcgaagatgtcgttgacgcagatgacaatccagttcccgcagatgatgaa
gaaacacaagatagtagcacagacttgaagaaggataaacttatcaagcagaaagccaaa
cctacgaagaggaagactgccaccagtaaacctggtggtagcaaaaaaaggaaaacgaaa
gcatga

Protein sequence

>854392 : length: 861
MVNISDFFGKNKKSVRSSTSRPTRQVGSSKPEVIDLDTESDQESTNKTPKKMPVSNVIDV
SETPEGEKKLPLPAKRKASSPTVKPASSKKTKPSSKSSDSASNITAQDVLDKIPSLDLSN
VHVKENAKFDFKSANSNADPDEIVSEIGSFPEGKPNCLLGLTIVFTGVLPTLERGASEAL
AKRYGARVTKSISSKTSVVVLGDEAGPKKLEKIKQLKIKAIDEEGFKQLIAGMPAEGGDG
EAAEKARRKLEEQHNIATKEAELLVKKEEERSKKLAATRVSGGHLERDNVVREEDKLWTV
KYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKT
TAAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFV
IIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDA
NSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEIS
KAWEKNIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQENYLSTR
PSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSLLPLHAVLSSVYPASKVAGHM
AGRINFTAWLGQNSKSAKYYRLLQEIHYHTRLGTSTDKIGLRLDYLPTFRKRLLDPFLKQ
GADAISSVIEVMDDYYLTKEDWDSIMEFFVGPDVTTAIIKKIPATVKSGFTRKYNSMTHP
VAIYRTGSTIGGGGVGTSTSTPDFEDVVDADDNPVPADDEETQDSSTDLKKDKLIKQKAK
PTKRKTATSKPGGSKKRKTKA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min