Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854424, CLP1

Organisms

Yeast (4932)

Synonyms

YOR250C;
Subunit of cleavage factor I (CFI), involved in both the endonucleolyitc cleavage and polyadenylation steps of mRNA 3'-end maturation

Description

Clp1p

Xrefs

SGD:S000005776

Chromosome

XV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 854424 PMID: 16429126
856626 854424 PMID: 17200106

Sequence Information

Nucleotide sequence

>854424 : length: 1338
atggcaagtctacctggtattgatgagcatactacctctgaagaattgataactggtgat
aacgaatggcacaagttggttattcccaagggcagtgattggcaaattgatcttaaagca
gagggaaaactgatagtcaaggtaaactcgggcatagttgagatatttggcaccgagttg
gcagtagatgatgagtacacttttcagaactggaagtttcccatatacgctgtcgaagaa
acagaattattatggaaatgtcctgatttaactacgaatacaataactgtcaagcctaac
catactatgaaatatatttataatctacacttcatgttggagaagatacgaatgtctaac
tttgaaggccctcgagtggtgattgttggtggttcgcaaaccgggaagacttccctatcg
aggacactatgttcttacgctttgaaattcaacgcttaccaaccactatacatcaatctt
gaccctcaacagcccatttttactgttcctggatgcatatctgccaccccaatatcagat
atacttgatgcacaactacccacttggggtcagagtctcactagtggtgccacactacta
cataataagcagccaatggtgaaaaattttggcctggaaaggattaatgagaacaaagat
ctataccttgagtgtataagccagttaggtcaagtagtaggtcaaaggttacatttggat
cctcaagtcaggagatcagggtgcattgtcgatacgccatcaatatcacaactggatgaa
aatttggctgaactgcaccatatcattgagaaactcaatgttaacattatgctagtacta
tgttctgaaacggatcctctttgggagaaagtaaaaaagacatttggtccagaattggga
aataataatatttttttcattcctaaattggatggtgtatccgcagttgatgatgtatac
aaaagatccttgcagaggacatccataagagagtacttttacggctctcttgatacagcc
ttgagtccttatgctattggtgttgattatgaggatttaactatttggaaacctagcaat
gttttcgataacgaggtcggtagggtggaactgttccccgtcactataactccaagtaac
ctacagcacgctattatagccataacgttcgcagaaagaagggcagatcaggcaacagta
ataaaatcgcctattttaggattcgctttgattacagaagttaatgaaaaaaggcgtaaa
ttaagggttttactacctgtcccaggccgacttcccagcaaggcgatgattctaacttca
tatagatatttagagtaa

Protein sequence

>854424 : length: 445
MASLPGIDEHTTSEELITGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTEL
AVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSN
FEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISD
ILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLD
PQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELG
NNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSN
VFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRK
LRVLLPVPGRLPSKAMILTSYRYLE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min