Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854542, PDE2

Organisms

Yeast (4932)

Synonyms

YOR360C;
SRA5;
Pde2p

Description

High-affinity cyclic AMP phosphodiesterase, component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon

Xrefs

SGD:S000005887

Chromosome

XV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 854542 PMID: 16554755
851152 854542 PMID: 16554755

Sequence Information

Nucleotide sequence

>854542 : length: 1581
atgtccaccctttttctgattggaatacacgagattgagaaatctcaaacaattgtacag
aatgaacactattttgatagagtgattgagcttcaagatttggattctctgatggtagca
ttgtataaggacagagtttcgccttttccaaacgtccataactttgaaacgggcgtatct
atagttctttatgacccttcaaaatttcaattatctgtgcgacaattggatgttctattc
aagcgatttttcccatctttcaatatttctgcgatagatcatacacgagaggaaaacctg
caacgtcttgaatgtgttgagcgtgaaaatagcatctgtcgtaatagaataacgagaatt
aaccactggatgtatcaccatcatgatgatactccagacggtattaacaaaaacagctat
ggtactgtaaatgggaattctgtccccactcaagcatgtgaagcaaacatttacacttta
ttattgcatttgaatgattccaaggcacaacatttacgaaaggcatcagtgccaaggcta
attcgcaacatcgagtttatgtcttttttgtcagatccaatagaaaaaatttctcaagag
ggatcacattattggaacattctatcaacttgggacttttgtgctttatcattaagcact
caagaattgatttggtgcgggttcacgcttatcaaaaagttatctaaggatgcaaaagta
ctcattgcagataataagttactgctactactatttactttagaatcatcctatcatcaa
gttaacaaatttcacaattttaggcatgccatcgatgtcatgcaagccacatggcgattg
tgtacatatcttcttaaagataatcctgtacaaacattactgttgtgtatggctgccata
ggtcatgatgtcggtcatcctgggactaacaatcaactattgtgcaactgtgaatcagag
gttgctcaaaatttcaaaaatgtctctatcttggagaattttcacagggaattatttcaa
caattgctatcagagcattggcctcaattgctatctatctccaaaaaaaaatttgatttt
atttccgaggctattctggccacagatatggcattgcattctcagtatgaggatagatta
atgcatgaaaacccaatgaaacaaatcactttgatatctctaattattaaagctgcagac
atctctaatgtgacgagaaccttgtcaatatcagcacgttgggcatacctcattactctc
gaatttaatgattgcgctcttttggaaacatttcataaagctcaccgcccagaacaagac
tgttttggcgattcatacaagaatgttgattctccgaaagaagatttggaatcaattcaa
aatattttggtgaacgtaacagaccctgatgatattatcaaagaccatccgcatattcca
aacggtcaaatatttttcattaatacgtttgctgaagtatttttcaacgcattaagtcaa
aaattctcaggattaaaatttttaagcgataatgtcaaaatcaataaagaatactggatg
aaacacaagaaaccacaatag

Protein sequence

>854542 : length: 526
MSTLFLIGIHEIEKSQTIVQNEHYFDRVIELQDLDSLMVALYKDRVSPFPNVHNFETGVS
IVLYDPSKFQLSVRQLDVLFKRFFPSFNISAIDHTREENLQRLECVERENSICRNRITRI
NHWMYHHHDDTPDGINKNSYGTVNGNSVPTQACEANIYTLLLHLNDSKAQHLRKASVPRL
IRNIEFMSFLSDPIEKISQEGSHYWNILSTWDFCALSLSTQELIWCGFTLIKKLSKDAKV
LIADNKLLLLLFTLESSYHQVNKFHNFRHAIDVMQATWRLCTYLLKDNPVQTLLLCMAAI
GHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHRELFQQLLSEHWPQLLSISKKKFDF
ISEAILATDMALHSQYEDRLMHENPMKQITLISLIIKAADISNVTRTLSISARWAYLITL
EFNDCALLETFHKAHRPEQDCFGDSYKNVDSPKEDLESIQNILVNVTDPDDIIKDHPHIP
NGQIFFINTFAEVFFNALSQKFSGLKFLSDNVKINKEYWMKHKKPQ



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min