Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854768, CBR1

Organisms

Yeast (4932)

Synonyms

YIL043C;
CBR5;
Microsomal cytochrome b reductase, not essential for viability; also detected in mitochondria; mutation in conserved NADH binding domain of the human ortholog results in type I methemoglobinemia

Description

Cbr1p

Xrefs

SGD:S000001305

Chromosome

IX : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 854768 PMID: 16554755

Sequence Information

Nucleotide sequence

>854768 : length: 855
atggctattgatgctcaaaagcttgtggtggtcatcgtgatcgtggtcgtgcctttgctc
ttcaagttcattatcggaccgaagaccaagcctgtgctggatcccaaaaggaatgacttc
caatcatttccgctggttgaaaaaaccatcttaacgcataatacttcgatgtacaagttc
gggctacctcatgctgacgacgtactcggtttaccaattggtcagcatatcgtaattaag
gccaatatcaatggtaaggatattaccagatcgtatacgcccacatcgttggatggagat
acaaagggaaactttgaattactagtgaagtcttaccccacaggtaacgtttctaagatg
attggagagttgaagataggtgactcgatccagatcaagggccctcgtgggaactatcat
tatgagagaaactgccgttcccatctagggatgattgctggtggtactggtattgcgccc
atgtatcagatcatgaaagctattgccatggaccctcacgacactaccaaggtctctcta
gtctttgggaacgtccatgaggaggatattctgttgaagaaggaactggaagcgttggtg
gccatgaagccttcccaatttaagatagtttactacttagactctcctgaccgtgaagac
tggactggtggtgtaggatacattaccaaggatgtcatcaaggaacacttgcccgctgct
acaatggacaacgttcaaattttgatctgtggtcctccagccatggttgcctcagttaga
agaagtaccgtggacttggggttcagacgttccaaaccgctttccaagatggaagaccag
gtgtttgtgttttaa

Protein sequence

>854768 : length: 284
MAIDAQKLVVVIVIVVVPLLFKFIIGPKTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKF
GLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKM
IGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSL
VFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHLPAA
TMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLSKMEDQVFVF



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min