Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854902, RPL6A

Organisms

Yeast (4932)

Synonyms

YML073C;
YL16A;
Rpl6ap

Description

N-terminally acetylated protein component of the large (60S) ribosomal subunit, has similarity to Rpl6Bp and to rat L6 ribosomal protein; binds to 5.8S rRNA

Xrefs

SGD:S000004538

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 854902 PMID: 17200106

Sequence Information

Nucleotide sequence

>854902 : length: 531
atgagtgcccaaaaagctccaaagtggtatccatccgaagacgtcgctgctctaaagaag
accagaaaggctgctcgcccacaaaagttgcgtgcctctctagttccaggtaccgtcttg
atcttactagctggtcgtttcagaggtaagagagttgtttacttgaagcatctagaagac
aacactttgttgatttctggtccattcaaggtcaatggtgttcctttgagaagagtcaat
gctcgttacgtcattgctacctctactaaggtttctgtcgaaggtgtcaacgttgaaaaa
ttcaatgtcgaatactttgctaaggaaaaattgactaagaaggaaaagaaggaagctaac
ttgttcccagaacaacaaaacaaggaaatcaaggctgaacgtgttgaagaccaaaaggtt
gtcgacaaggctttgattgctgaaatcaagaagactccattattgaagcaatacttgtct
gcttctttctctttgaagaacggtgacaagccacacatgttgaaattttaa

Protein sequence

>854902 : length: 176
MSAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLED
NTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFAKEKLTKKEKKEAN
LFPEQQNKEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDKPHMLKF



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min