Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854940, MFT1

Organisms

Yeast (4932)

Synonyms

YML062C;
MFT52;
Subunit of the THO complex, which is a nuclear complex comprised of Hpr1p, Mft1p, Rlr1p, and Thp2p, that is involved in transcription elongation and mitotic recombination; involved in telomere maintenance

Description

Mft1p

Xrefs

SGD:S000004527

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 854940 PMID: 16429126

Sequence Information

Nucleotide sequence

>854940 : length: 1179
atgcctctgtcacaaaaacaaatagaccaagttagaaccaaagtgcactacagtgaagta
gatactccattcaataaatatttagacatcttaggaaaagtaaccaagctgacaggaagc
attataaatggcacattatccaatgatgatagcaagattgaaaaacttactgagcaaaat
atctcccaactaaaagaaagtgctcatcttcgatttttggatctgcagtcatcaattgac
acaaagaaagtagcagacgaaaattgggaaacatgccaacaggagacattggccaagctg
gaaaatctcaaagataaattgcctgatataaagagcatccatagcaagttgcttttacgt
attggaaaactacaaggtctttacgattctgtccaagtaattaacagagaggtggaaggc
ttgtcagaaggccgtaccagccttgtggtgacacgtgcggaatgggagaaagaacttggc
actgatctggtcaagtttttaattgaaaagaattatctcaaactagttgatccgggcctg
aaaaaggatagttcagaggagagatatcgtatttatgacgatttctctaagggcccaaaa
gagttagaaagtatcaacgcctcaatgaaatcggatatagaaaacgtaaggcaggaggta
tcgtcttacaaagagaagtggctaagagatgcagaaatatttggcaagatcacatcaata
ttcaaagaagaacttctgaagagagatggcctgctcaatgaggcagaaggagataacatt
gatgaagattatgaatcggatgaagatgaggaaagaaaagagaggtttaaaaggcagaga
tcaatggtggaagtgaatactatagaaaatgtggacgaaaaagaggaaagcgatcatgaa
tatgacgatcaggaggatgaagaaaatgaagaggaagatgatatggaagtagacgttgag
gatataaaagaggataatgaagttgatggggaaagcagtcaacaagaagataatagtcgc
cagggtaataatgaggaaacagacaaagaaactggagtgatagaagagccagatgcggtt
aatgacgcagaggaggcagatagcgatcactcaagcaggaaacttggaggcactacaagc
gattttagtgcgtcttcctctgttgaagaagtaaaatga

Protein sequence

>854940 : length: 392
MPLSQKQIDQVRTKVHYSEVDTPFNKYLDILGKVTKLTGSIINGTLSNDDSKIEKLTEQN
ISQLKESAHLRFLDLQSSIDTKKVADENWETCQQETLAKLENLKDKLPDIKSIHSKLLLR
IGKLQGLYDSVQVINREVEGLSEGRTSLVVTRAEWEKELGTDLVKFLIEKNYLKLVDPGL
KKDSSEERYRIYDDFSKGPKELESINASMKSDIENVRQEVSSYKEKWLRDAEIFGKITSI
FKEELLKRDGLLNEAEGDNIDEDYESDEDEERKERFKRQRSMVEVNTIENVDEKEESDHE
YDDQEDEENEEEDDMEVDVEDIKEDNEVDGESSQQEDNSRQGNNEETDKETGVIEEPDAV
NDAEEADSDHSSRKLGGTTSDFSASSSVEEVK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min