Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

854948, IMD4

Organisms

Yeast (4932)

Synonyms

YML056C;
Inosine monophosphate dehydrogenase, catalyzes the first step of GMP biosynthesis, member of a four-gene family in S. cerevisiae, constitutively expressed

Description

Imd4p

Xrefs

SGD:S000004520| SGD:S000006445

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 854948 PMID: 16429126
856626 854948 PMID: 12746440
856626 854948 PMID: 17200106
856626 854948 PMID: 16554755
854948 852296 PMID: 16554755
854948 856885 PMID: 11805837
854948 854026 PMID: 16429126
854948 854026 PMID: 17200106
854948 856839 PMID: 17200106
854948 854542 PMID: 16554755
854948 851152 PMID: 14759368
854948 851152 PMID: 16429126
854948 851152 PMID: 18467557
854948 851152 PMID: 17200106
854948 851152 PMID: 16554755
854948 851988 PMID: 15584090
854948 851025 PMID: 18467557
854948 855881 PMID: 16429126
854948 852702 PMID: 16429126
854948 852702 PMID: 17200106
854948 852953 PMID: 16554755
854948 852206 PMID: 16429126
854948 854034 PMID: 11805837
854948 856290 PMID: 16429126
854948 854999 PMID: 12556496
854948 851589 PMID: 17200106
854948 853610 PMID: 16429126
854948 853610 PMID: 17200106
854948 852804 PMID: 17200106
854948 850623 PMID: 11804584
854948 853178 PMID: 14519092
854948 853178 PMID: 11805837
854948 851114 PMID: 16554755
854948 855408 PMID: 16429126
854948 850594 PMID: 14660704
854948 853395 PMID: 16429126
854948 855903 PMID: 16429126
854948 855903 PMID: 17200106
854948 856853 PMID: 11805837
854948 853165 PMID: 16429126
854948 854229 PMID: 17200106
854948 852487 PMID: 17200106
854948 852757 PMID: 16429126
854948 851045 PMID: 16554755
854948 854731 PMID: 11805837
854948 851099 PMID: 11805837
854948 856912 PMID: 16429126
854948 855599 PMID: 15798213
854948 856626 PMID: 16429126
854948 856626 PMID: 12746440
854948 856626 PMID: 17200106
854948 856626 PMID: 16554755
854948 853344 PMID: 16429126
854948 853728 PMID: 16429126
854948 856507 PMID: 11805837
854948 852385 PMID: 11805837
854948 854157 PMID: 18467557
854948 855083 PMID: 16429126
854948 853152 PMID: 16554755
854948 851147 PMID: 11805837
854948 850320 PMID: 17200106
854948 855491 PMID: 11805837
854948 854417 PMID: 16429126
854948 852742 PMID: 17200106
854948 854078 PMID: 16429126
854948 853465 PMID: 16429126
854948 854948 PMID: 18467557
854948 851204 PMID: 16429126
851152 854948 PMID: 14759368
851152 854948 PMID: 16429126
851152 854948 PMID: 18467557
851152 854948 PMID: 17200106
851152 854948 PMID: 16554755

Sequence Information

Nucleotide sequence

>854948 : length: 1575
atgagtgctgctccattggattacaaaaaggctttagaacatttgaagacatacagttcc
aaggacggtctttctgtccaggaattgatggactccacaactagaggtgggttgacctac
aatgattttttggtcttaccaggcttggtcaatttcccatcttctgctgtcagtttgcaa
accaaattgaccaagaaaatcactttgaacactccttttgtctcttctcctatggacaca
gtcactgaagctgatatggctatttatatggctttattgggtggtattggtttcatccat
cacaactgtactccaaaggaacaggcttccatggtcaagaaagttaaaatgtttgaaaac
ggtttcatcaattctccaatagtaatttctccaaccaccactgttggtgaagttaaggtt
atgaagagaaagtttggtttctctggcttcccagttactgaagacggtaagtgtccaggt
aagttagttgggttagtcacctctcgtgatatacaattcttagaagatgattctttggtt
gtttctgaagtcatgactaaaaatccagttactggcatcaagggtattactttgaaagaa
ggtaatgaaatcctaaaacaaaccaagaaaggtaaattgcttatcgttgatgataacggt
aacctcgtttccatgttgtcaagagcggatttgatgaagaatcaaaactacccgttagct
tctaaatccgccaccaccaagcaattgctatgtggtgctgcaattggtactatcgaagct
gataaggaaagattaagactattagtcgaagcaggtttggatgttgttatcttagattcc
tctcaaggtaactctgttttccaattgaacatgatcaaatggattaaagaaactttccca
gatttggaaatcattgctggtaacgttgccaccagagaacaagctgctaacttgattgct
gccggtgccgatggtttaagaattggtatgggttctgggtctatttgtatcactcaagaa
gttatggcttgtggtagaccacaaggtacagctgtctacaacgtttgtcaatttgctaac
caatttggcgttccatgtatggctgatggtggtgtccaaaacattggccacatcaccaag
gctttggcccttggttcctccaccgtcatgatgggtggtatgttagctggtactaccgag
tcaccaggtgaatacttctacaaggatggtaagagattgaaggcttatcgtggtatgggg
tccattgacgccatgcaaaagaccggtaacaagggtaatgcctctacttctcgttatttc
tctgagtcagacagtgtcttggttgcacaaggtgtttctggggctgtcgtagacaaaggt
tccatcaagaagtttattccatatttgtacaacggtttacaacattcttgtcaagacatt
ggttgcgaatctctaacttcattgaaagagaatgttcaaaatggtgaagttagatttgaa
ttcagaaccgcttctgctcaattagaaggtggtgtccataatttgcactcctatgaaaaa
cgtctatacaattga

Protein sequence

>854948 : length: 524
MSAAPLDYKKALEHLKTYSSKDGLSVQELMDSTTRGGLTYNDFLVLPGLVNFPSSAVSLQ
TKLTKKITLNTPFVSSPMDTVTEADMAIYMALLGGIGFIHHNCTPKEQASMVKKVKMFEN
GFINSPIVISPTTTVGEVKVMKRKFGFSGFPVTEDGKCPGKLVGLVTSRDIQFLEDDSLV
VSEVMTKNPVTGIKGITLKEGNEILKQTKKGKLLIVDDNGNLVSMLSRADLMKNQNYPLA
SKSATTKQLLCGAAIGTIEADKERLRLLVEAGLDVVILDSSQGNSVFQLNMIKWIKETFP
DLEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCQFAN
QFGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYKDGKRLKAYRGMG
SIDAMQKTGNKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDI
GCESLTSLKENVQNGEVRFEFRTASAQLEGGVHNLHSYEKRLYN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min