Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855044, FAR8

Organisms

Yeast (4932)

Synonyms

YMR029C;
Protein involved in G1 cell cycle arrest in response to pheromone, in a pathway different from the Far1p-dependent pathway; interacts with Far3p, Far7p, Far9p, Far10p, and Far11p

Description

Far8p

Xrefs

SGD:S000004631

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855044 PMID: 16429126

Sequence Information

Nucleotide sequence

>855044 : length: 1572
atggctattaaccaggcacatgttcatccgcattacacgttacctggtgtaatgcactac
ttgcaaacggagttcacgaagaatgaaagagatagaatcacctgggagctagaaaggtcg
gaaatgaaagcaagaattgcagaactagagggcgaaaatagagatttgaagcatcaattg
aatcaaatacaatcgaaagctgtttctcctgaaggtgaaaaggaagaaaaacatgtgcct
gattcattactgcagtctaagctagctgttcaagaaaatgtgaaggaaataatttatttg
ttgaaaggccctaacacggtcaatcagttagagtcattaaatagcagagaagcgggttct
gaattgcacgatttagagaaactgaacgtgaatactcccaaggaagagggcagtgcgaag
acaaatgggatggatattttaaataatgccctcttggacaccaaacccaatccaaagcaa
ggtccttcagagtcaccatcaccaaccaaagtgaaatctttgtttagcacagccaacaag
cgtgaaaataatgaaacaatatccaagatacactcggaattgtcgaaagtcgacattatc
agctcctacggggactgtatggcactttatgatgcagacaccaaatcgttagaaatacac
caagtggacgcaaacttgaattccaaactcttaaagaaaatatctttagggcaagatagc
gacattatgaaatttttctgggtttcgacgtccaaactccttgttattgaaaagagtttc
catttgaaattgttctctatttctagcgcatctttgatctcagatgtggacctattacaa
gactcagaacagccgttttcgtctagtgatatcattaatatagacttcaaaaataaatgg
ttgttgatagctagtaagaataaatctcaaattagaatctgggaattggacaatatagag
gctcctgaggatgtcccaattaacataaaagaaacatatgaaataacacatgataatgat
gacgatgatagtaatgattccacaaacattctggattgtatattgggtataacagaaaaa
tccttaatattactgtcttcaaatccataccagcttaccatatatgatttcgagggtaag
cttctacaaaaaattgatttgaagattgatacaatattatcgggtaagccagaagaagaa
ggttaccatttatttttggatagaaaaacttctaagctactgattcagctaagcaatgag
agattattggtttattcttttgataagaaaaaagttgtactgaaggaacaattgactcca
tcgtcaacactaccaatacaactcgatttgaacgacagcataatcaccgtatcatatagt
aatggagactttgagtttaggaatttagaaaacctaaaaccatccatcgacgaatttgtc
gtagcagacatcaacttctcggaaagaaaagagcctgtggtattttcttcaaatctgatt
gtagattctacgccggtgttaatcaccgtgaataaaaataacgaagtccttttgcacaag
attaaaatataa

Protein sequence

>855044 : length: 523
MAINQAHVHPHYTLPGVMHYLQTEFTKNERDRITWELERSEMKARIAELEGENRDLKHQL
NQIQSKAVSPEGEKEEKHVPDSLLQSKLAVQENVKEIIYLLKGPNTVNQLESLNSREAGS
ELHDLEKLNVNTPKEEGSAKTNGMDILNNALLDTKPNPKQGPSESPSPTKVKSLFSTANK
RENNETISKIHSELSKVDIISSYGDCMALYDADTKSLEIHQVDANLNSKLLKKISLGQDS
DIMKFFWVSTSKLLVIEKSFHLKLFSISSASLISDVDLLQDSEQPFSSSDIINIDFKNKW
LLIASKNKSQIRIWELDNIEAPEDVPINIKETYEITHDNDDDDSNDSTNILDCILGITEK
SLILLSSNPYQLTIYDFEGKLLQKIDLKIDTILSGKPEEEGYHLFLDRKTSKLLIQLSNE
RLLVYSFDKKKVVLKEQLTPSSTLPIQLDLNDSIITVSYSNGDFEFRNLENLKPSIDEFV
VADINFSERKEPVVFSSNLIVDSTPVLITVNKNNEVLLHKIKI



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min