Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855083, RNA14

Organisms

Yeast (4932)

Synonyms

YMR061W;
Rna14p

Description

Cleavage and polyadenylation factor I (CF I) component involved in cleavage and polyadenylation of mRNA 3' ends; bridges interaction between Rna15p and Hrp1p in the CF I complex

Xrefs

SGD:S000004665

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855083 PMID: 16429126
854948 855083 PMID: 16429126

Sequence Information

Nucleotide sequence

>855083 : length: 2034
atgtccagctctacgactcctgatttactatatccctctgcggacaaagtcgcagagcct
agtgacaatatacatggagatgaactacgacttagagaaaggattaaagacaatcccacg
aatattttatcatacttccagcttattcaatatttggaaactcaagagtcatacgctaag
gtgagagaagtatacgagcaatttcataacacattcccgttttattcacctgcgtggact
ttgcaactaaagggtgaattggcaagagatgaatttgagactgttgagaagattttggct
caatgtctttctggcaagttggaaaataatgacctatctctttggtcaacatatttggac
tacatacgcagaaaaaacaacttaattactggtggacaagaggcgagagctgttattgtc
aaggcattccaactagttatgcaaaagtgtgcaatttttgaacccaaatcatcttctttt
tggaacgaatatctcaattttttagagcagtggaagccattcaacaaatgggaggagcaa
cagcgaattgacatgctcagagaattctacaagaaaatgctatgtgttccttttgataat
ctagaaaaaatgtggaatagatacactcaatgggaacaagaaataaattccctaacagcc
agaaaatttattggcgagttatcagccgaatacatgaaagcccgttccttataccaggaa
tggttgaacgttactaatggattgaaaagggcatctccaattaatctgcgcacagcaaac
aagaaaaacataccacaaccaggtacctcagactcaaacattcagcagttacagatttgg
ttgaattggataaaatgggaaagggagaataagttgatgcttagtgaagatatgctatca
caaagaatcagttacgtttataaacaaggtattcaatacatgatattttctgctgaaatg
tggtacgattattcaatgtatatatctgaaaattcggatcgacaaaatatcttatatact
gcgttattagctaatcccgactcaccttctcttacattcaagttatccgaatgctacgaa
ctggataatgattctgaaagtgtttctaactgttttgacaagtgcactcaaactttacta
tcgcagtataaaaagatcgcctccgatgtaaattcgggtgaagataataacacagagtat
gaacaagagctgctatacaaacagagggaaaaattaacattcgtgttttgcgtgtatatg
aatacgatgaaaagaatatcaggactatccgcagcacgtactgtatttggtaaatgtcgt
aaactgaagcgtatattaacacatgacgtctacgtggaaaatgcatatttagaatttcaa
aatcaaaacgattataagactgcttttaaggttttagaattgggtttaaaatacttccaa
aacgatggagtttatatcaacaaatacttagattttttaatatttttaaataaggattcg
cagatcaaaaccttatttgaaacatcagtggaaaaagtgcaagatttaacccagctgaag
gaaatatacaagaaaatgataagttatgaatcgaaattcggtaacttaaacaacgtttat
tctctagagaaaagatttttcgaacggttcccccaagaaaatttgattgaagttttcaca
agtcgttatcaaattcaaaactccaacttaataaagaaattagagttaacttatatgtat
aatgaggaagaagacagttacttttcttctggaaacggggatggccatcatggctcttac
aatatgagttcgtcagatagaaagagactaatggaggaaactggaaacaatggaaacttc
tccaataagaaattcaaaagagactcagagcttccaacagaggttcttgatttattgagc
gttataccaaaacgtcaatattttaatacaaatttactcgatgcgcagaaattggtgaat
tttttaaatgatcaagtagagattccaacagttgagagcaccaagtcaggttaa

Protein sequence

>855083 : length: 677
MSSSTTPDLLYPSADKVAEPSDNIHGDELRLRERIKDNPTNILSYFQLIQYLETQESYAK
VREVYEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLSLWSTYLD
YIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSSFWNEYLNFLEQWKPFNKWEEQ
QRIDMLREFYKKMLCVPFDNLEKMWNRYTQWEQEINSLTARKFIGELSAEYMKARSLYQE
WLNVTNGLKRASPINLRTANKKNIPQPGTSDSNIQQLQIWLNWIKWERENKLMLSEDMLS
QRISYVYKQGIQYMIFSAEMWYDYSMYISENSDRQNILYTALLANPDSPSLTFKLSECYE
LDNDSESVSNCFDKCTQTLLSQYKKIASDVNSGEDNNTEYEQELLYKQREKLTFVFCVYM
NTMKRISGLSAARTVFGKCRKLKRILTHDVYVENAYLEFQNQNDYKTAFKVLELGLKYFQ
NDGVYINKYLDFLIFLNKDSQIKTLFETSVEKVQDLTQLKEIYKKMISYESKFGNLNNVY
SLEKRFFERFPQENLIEVFTSRYQIQNSNLIKKLELTYMYNEEEDSYFSSGNGDGHHGSY
NMSSSDRKRLMEETGNNGNFSNKKFKRDSELPTEVLDLLSVIPKRQYFNTNLLDAQKLVN
FLNDQVEIPTVESTKSG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min