Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855173, RPL13B

Organisms

Yeast (4932)

Synonyms

YMR142C;
Rpl13bp

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein

Xrefs

SGD:S000004750

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855173 PMID: 17200106

Sequence Information

Nucleotide sequence

>855173 : length: 600
atggctatctccaagaatttaccaattttgaagaaccacttcagaaagcactggcaagaa
cgtgtcaaggttcactttgaccaagctggtaaaaaggtttctagacgtaatgctagagct
gccagagccgccaagattgctccaagaccattggatttgttgagacctgttgtcagagct
ccaactgttaagtacaacagaaaggttagagctggtagaggtttcaccttggctgaagtt
aaggccgctggtttgactgctgcttacgccagaaccattggtattgctgttgaccacaga
cgtcaaaacagaaaccaagaaatctttgacgctaacgttcaaagattgaaggagtaccaa
tccaagattatcgttttcccaagagacggtaaggctccagaagctgaacaagttttgtct
gctgctgccactttcccaattgctcaaccagctaccgatgttgaagctagagctgttcaa
gacaatggtgaatctgctttcagaaccttgagattagccagatccgaaaagaaattcaga
ggtatcagagaaaagagggctagagagaaggctgaagctgaagctgaaaagaagaaataa

Protein sequence

>855173 : length: 199
MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLDLLRPVVRA
PTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQ
SKIIVFPRDGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNGESAFRTLRLARSEKKFR
GIREKRAREKAEAEAEKKK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min