Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855335, HAS1

Organisms

Yeast (4932)

Synonyms

YMR290C;
Has1p

Description

ATP-dependent RNA helicase; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles

Xrefs

SGD:S000004903

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 855335 PMID: 17200106

Sequence Information

Nucleotide sequence

>855335 : length: 1518
atggctaccccgtcaaataaacgttctagagattctgaatctacagaagaacctgtagta
gatgaaaagagcacttcaaaacaaaacaatgccgcacctgagggagaacaaactacttgt
gtggaaaagttcgaagaactaaagttatcacagccaactttaaaggccattgaaaagatg
ggatttaccactatgacttctgttcaggcaaggactatcccacctcttttggccggtagg
gatgttcttggtgctgccaagacaggttctggtaaaactctagcgtttctcatccctgct
attgaactattgcattctttgaaattcaaaccaagaaatggtaccggtataattgtcatt
acgcctacaagagagttggctttacagatttttggagtggcaagagagttaatggaattc
cattcacagacatttggtattgtcattggtggtgcaaatagaagacaggaagccgaaaaa
ttgatgaaaggtgttaacatgttgattgctacccctggaagattattggatcacttacaa
aatacaaaaggatttgtattcaagaacttgaaggctttgattatcgatgaagcggacaga
atcttagaaattgggtttgaagatgaaatgaggcagataattaagatcttgccaaacgaa
gataggcaatccatgttattttcagctacacaaacgaccaaagttgaggatttggctaga
atctcgctgagaccgggccctcttttcattaatgtcgttcctgaaaccgacaactccacc
gcagatggattagaacaaggctatgtggtatgtgacagtgataagagatttttgttgtta
ttttctttcttgaaaagaaatcaaaaaaagaaaattattgtatttttatcatcttgtaac
tctgtgaaatattacgctgaattattgaactatattgatttgccagtcctcgaattacac
ggtaagcaaaaacaacaaaagagaacaaatacatttttcgaattctgtaatgcggaaaga
ggtatcttgatttgtacagatgtcgcagctagagggctagatatccctgctgtggactgg
atcattcaattcgaccctcctgatgatccaagagattatattcatagagtcggaagaacc
gcaagaggcactaaaggtaagggtaaatctttaatgtttttaacacctaatgaattaggg
tttttaagatatctaaaggcttccaaggtcccattaaatgagtacgaattcccggaaaac
aaaattgcaaacgttcaatcacaattagaaaaattaattaaatccaactattatctacat
caaacagccaaggatggttatagatcttatttacaagcgtacgcttcccactctttgaaa
actgtctatcaaatcgataagctggatttagccaaagtagcaaagtcttacggttttcca
gtccctccaaaggttaacattacaattggtgccagtggaaaaacgccaaataccaaaaga
cgtaaaactcataagtaa

Protein sequence

>855335 : length: 505
MATPSNKRSRDSESTEEPVVDEKSTSKQNNAAPEGEQTTCVEKFEELKLSQPTLKAIEKM
GFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLHSLKFKPRNGTGIIVI
TPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQ
NTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLAR
ISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCN
SVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDW
IIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKASKVPLNEYEFPEN
KIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFP
VPPKVNITIGASGKTPNTKRRKTHK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min