Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855357, NIP1

Organisms

Yeast (4932)

Synonyms

YMR309C;
Subunit of the eukaryotic translation initiation factor 3 (eIF3), involved in the assembly of preinitiation complex and start codon selection

Description

Nip1p

Xrefs

SGD:S000004926

Chromosome

XIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 855357 PMID: 16429126

Sequence Information

Nucleotide sequence

>855357 : length: 2439
atgtcccgtttcttttcgtctaattacgaatacgatgtagccagttcttcatccgaagaa
gatcttttatcttcgtctgaagaagatttgttaagctcttcctcctctgagtctgaattg
gaccaagaatctgacgactcctttttcaatgaaagtgaaagtgaaagtgaagctgatgta
gactctgatgattctgatgcaaagccttatggtcctgactggttcaagaaatctgagttc
agaaaacaaggtggaggttcaaataaatttttgaaaagctctaactatgattccagtgat
gaagaatccgatgaagaagatggcaagaaggtagtcaagtctgccaaagaaaaactattg
gatgaaatgcaagacgtttataataagatctctcaagctgagaactctgatgactggttg
actatttctaatgagtttgatttgatctcgcgtctcttagttagggctcaacaacaaaac
tgggggactccaaatattttcatcaaggttgttgcccaagtggaggacgctgtgaataat
acacaacaagctgatttgaagaataaagctgttgcaagagcttataacactacaaagcaa
agagtcaagaaagtttctagagaaaatgaagactcaatggctaaattcagaaatgatcct
gaatcatttgataaggaaccaaccgcagatttggatatttctgctaatggattcacaatt
tcttcgtctcaaggcaatgaccaagcggtacaagaagatttcttcactagattacaaaca
ataattgactcaagaggtaagaagactgtcaatcaacaatccttgatttctactttggag
gagttattaactgtagctgaaaaaccatatgaattcataatggcttatttgactttgatt
ccatcaagattcgatgcctcagctaacctatcttaccaaccaattgatcaatggaaatct
tcattcaacgatattagtaaattattgtctattttagaccagacaattgacacctaccaa
gttaatgaatttgctgatccaatcgatttcattgaagatgaacctaaagaagattctgat
ggtgtcaagaggattctgggttccattttctcatttgttgaaagattagatgacgaattc
atgaaatccctgttaaacatcgatcctcattccagtgattatttgatccgtttaagggat
gaacaatcaatctataatttgatcctaagaactcaattgtactttgaagcgactttgaaa
gatgaacacgacctagaaagagcattgacacgtccattcgtcaagagattggatcatatc
tactataaatccgaaaatttgataaaaattatggaaactgctgcttggaatatcatacct
gctcaattcaaatctaaatttacttcaaaagaccagctcgattctgctgattatgtcgac
aatttaatagacggattatcgacaatcttatccaagcaaaacaacattgctgttcaaaaa
cgtgctattttatacaacatttactacactgcattaaacaaagatttccaaactgctaaa
gatatgttactaacttcccaagttcaaacaaatatcaaccaattcgattcatccctacaa
attttattcaacagggttgttgttcaattgggtctatccgcctttaaattatgtttgatt
gaagaatgtcatcaaattttgaatgatcttctgtcaagttctcacttaagagaaattttg
ggccaacaatccctacacagaatatctctcaattctagtaacaatgcttcagctgatgag
cgtgctagacaatgtttgccatatcaccaacacatcaatctcgatttaatcgatgtcgtc
ttcttaacatgttccttattgatcgaaattccaagaatgactgccttctattccggtatt
aaggtcaagagaattccttactctccaaaatccattcgtcgttccttagaacattacgac
aagttaagtttccaaggtccaccagaaactttaagagattatgtcttgtttgctgccaaa
tcaatgcaaaaaggtaactggagagactctgttaaatacttaagagaaataaaatcttgg
gctttattaccaaacatggaaacggtgttgaatagtttaacggaaagagtacaagttgaa
tctttgaagacttatttcttttctttcaagaggttctattcaagtttttctgttgctaaa
ctagccgaattatttgatcttccagaaaataaggtggttgaagttttgcaatctgttatc
gcagaattggaaatcccagccaaattaaacgacgagaagaccatctttgttgtcgaaaag
ggtgatgaaattactaaattggaagaagcaatggtaaaattgaacaaagaatataaaatc
gctaaagaacgtcttaacccaccatcaaatcgtcgttga

Protein sequence

>855357 : length: 812
MSRFFSSNYEYDVASSSSEEDLLSSSEEDLLSSSSSESELDQESDDSFFNESESESEADV
DSDDSDAKPYGPDWFKKSEFRKQGGGSNKFLKSSNYDSSDEESDEEDGKKVVKSAKEKLL
DEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQQNWGTPNIFIKVVAQVEDAVNN
TQQADLKNKAVARAYNTTKQRVKKVSRENEDSMAKFRNDPESFDKEPTADLDISANGFTI
SSSQGNDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLI
PSRFDASANLSYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDFIEDEPKEDSD
GVKRILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLK
DEHDLERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVD
NLIDGLSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQ
ILFNRVVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADE
RARQCLPYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYD
KLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKSWALLPNMETVLNSLTERVQVE
SLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEK
GDEITKLEEAMVKLNKEYKIAKERLNPPSNRR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min