Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855408, KRI1

Organisms

Yeast (4932)

Synonyms

YNL308C;
Kri1p

Description

Essential nucleolar protein required for 40S ribosome biogenesis; physically and functionally interacts with Krr1p

Xrefs

SGD:S000005252

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855408 PMID: 16429126
854948 855408 PMID: 16429126

Sequence Information

Nucleotide sequence

>855408 : length: 1776
atgccaagaaaaaagtctgccgctaaaagagctagagaacaagcaaaaaaagaagcggcc
gtacctgcaacggatactgctaccataaaaacttctgaaacctctgcgacgacagttaag
cctgcaatcgaagcaagcaaatcgtacgttcctagtgaagatgaggaagaagacgaagag
gaagaagaggaggaagatgattacggtgaattgattactgatgaagtggaaaacggtatt
aatcaagtgctagatgccatcaaaaacaataagacggacaaactactagatcctaaagtc
aaattcttcgaggatcccgaatctgctgctgccaaactggccaatcgtgaggggaagcat
aaacctatttacctaaaagattatcaccgtatgaacatactttctggtgatgccttaaag
gaggatgacgaagaatacgaacatgcaactgttgacggaaagcaatctttcgtctcgcaa
caacgtgaagagaaaactcagcttttaaatgaaatcaagagtgcctttagcgatgaagaa
aatgaagagtctagcggagatgaagacgatgggtttttgaagaaaaaggaaccttctacg
aagaaggaaggaaaaaatttaccggatccaaccgtaaatgaagaaaatttcttggaagaa
tttgtgaatcaacaggcctggattcctaagaagggggacaaggtgatttctcttgacctc
aacaataatgaagaggacgatgaagaatttgaagatgctgcagaaaaatttgagaatgcc
tacaattttaggtacgaggacccaaacgcagctgaaattatatcttatgcacgtagtcaa
gctacactaagaagatccgatgactcttcacgcagaagaaaaagagaggaaaaaagaaaa
attaaagagcaaataaaagcagagaaggagacagctcttcagaaaaagaagactaaaaaa
ttgaataaattgactgacattttagagcaactaacaaaggaatatggtgctgaaattaat
gccgacatggtgaaaaaaatcactgacaccctattgaagaacgatttcaaagaagaagag
tgggataacgtggtagctgaattatttaatgaagaattttatcaacaagagggaaagcct
acctggaacgaggatgacgaaataatgggtgacttttatgcagacgccgatggtgatgac
caaacagaagaaggtgaagtggaaaaagaacaaaaagaagaagacgaggaagaaggtcca
aaaagaaagaagagcaagaaagaagagaaactgcaaaagaagaaagaaaagagaaaggta
aatgaattagtggaaaatgctttggaacaaaacaaactagcactaatagaggaggttgaa
aaagaagaagaagaaagaaagagtagaagccgtacaaaagaggagcaagatttgaagttt
cgttaccgtgaagtttctcctgagagtttcggtttgaccgcaagagagattttcgccgcc
gatgatactgatttaaatgaatttattggtttgaagaaatttgcaccttatcgttccaag
gaactaagagcgaaggataaaaggaaagtgatgaaggcaagaagattaagagagtggagg
aagaaaacttttaagaacgaaaatgggttagctccagtcgaagcagaggcaggggagaag
gatgaggacaccatactgatacctgtagagaaagcctctaaaagcaaacacaagaggggg
cacagtcataaacataaaggccaccagaaaaagtaa

Protein sequence

>855408 : length: 591
MPRKKSAAKRAREQAKKEAAVPATDTATIKTSETSATTVKPAIEASKSYVPSEDEEEDEE
EEEEEDDYGELITDEVENGINQVLDAIKNNKTDKLLDPKVKFFEDPESAAAKLANREGKH
KPIYLKDYHRMNILSGDALKEDDEEYEHATVDGKQSFVSQQREEKTQLLNEIKSAFSDEE
NEESSGDEDDGFLKKKEPSTKKEGKNLPDPTVNEENFLEEFVNQQAWIPKKGDKVISLDL
NNNEEDDEEFEDAAEKFENAYNFRYEDPNAAEIISYARSQATLRRSDDSSRRRKREEKRK
IKEQIKAEKETALQKKKTKKLNKLTDILEQLTKEYGAEINADMVKKITDTLLKNDFKEEE
WDNVVAELFNEEFYQQEGKPTWNEDDEIMGDFYADADGDDQTEEGEVEKEQKEEDEEEGP
KRKKSKKEEKLQKKKEKRKVNELVENALEQNKLALIEEVEKEEEERKSRSRTKEEQDLKF
RYREVSPESFGLTAREIFAADDTDLNEFIGLKKFAPYRSKELRAKDKRKVMKARRLREWR
KKTFKNENGLAPVEAEAGEKDEDTILIPVEKASKSKHKRGHSHKHKGHQKK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min