Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855491, ELA1

Organisms

Yeast (4932)

Synonyms

YNL230C;
Elongin A, F-box protein that forms a heterodimer with Elc1p and is required for ubiquitin-dependent degredation of the RNA Polymerase II subunit RPO21; subunit of the Elongin-Cullin-Socs (ECS) ligase complex

Description

Ela1p

Xrefs

SGD:S000005174

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 855491 PMID: 11805837
851152 855491 PMID: 11805837

Sequence Information

Nucleotide sequence

>855491 : length: 1140
atgaaaagtttacaaacactatgtgaaatctcattgatgagaaatcattcaaacatacaa
tctgtgagtaatgtcccctatcacttattaaagaggatactgcagaaagtaaaaatacca
caactattaaaacttgagaaaagcaacgtactattgatatttgacgatgatgaactatgg
ttagaatttttaaggcaagatttcccgactaatgtacacgaacaatttgtctctaagaga
gacattatttgcaaatattactttgatttcgttaaggaaaacgatatagaactgtaccat
tcgaatcaggatttattgaagtcttgcgtgcgtcaatcagtcgtcaaagacatccgaaac
aacaagtaccgaataccatacagaatgttatactcaaagtaccaacaagaagtggaaaag
aaacaagaggaaagcgcagagagattaaggctggaaatgcagaagttgcagcaagaaaga
gaaaaaaagcaaaccatagtggttgaccacactgtttacttcaaaaagagaaacaccaag
aagactacaaggttgcacaacgaaccccattcgcaattatacatgaaatcgttgaaagat
cacgagtccagactaaagcatttcaaagacggcggattcaacattgcaaaaaggcatgcg
caacgtgtggcctttggtggccaagcgggcggacaatcgtcttcccccaagaaaggccca
ttgtccatcaaaccggagcctgttaaggtaaatcgtcaaatggataatgtcacagcagag
aagaaagatgttacgcagcccatcacgccggtgaagaagagaagatccgaatcaccgtca
atctttctcaatcgtaaaaaacctgcgctattcaggcctactccgaagacaaacgctgca
ggttctcgaccccatacaacagcgatcaccaacgatcaccgtactacttctcatccttat
ccccacaaagatgttgtaacttcaatatcaagtgtcaccgcaaatcccgtaacaaagggc
cacaagaagaagaaatccggaattttcgtacgaaatgccggatctgacggagatagtttt
ccgcacgtgaccgcaaccggccctactacccgtccgtatatctatgagccacggaaatag

Protein sequence

>855491 : length: 379
MKSLQTLCEISLMRNHSNIQSVSNVPYHLLKRILQKVKIPQLLKLEKSNVLLIFDDDELW
LEFLRQDFPTNVHEQFVSKRDIICKYYFDFVKENDIELYHSNQDLLKSCVRQSVVKDIRN
NKYRIPYRMLYSKYQQEVEKKQEESAERLRLEMQKLQQEREKKQTIVVDHTVYFKKRNTK
KTTRLHNEPHSQLYMKSLKDHESRLKHFKDGGFNIAKRHAQRVAFGGQAGGQSSSPKKGP
LSIKPEPVKVNRQMDNVTAEKKDVTQPITPVKKRRSESPSIFLNRKKPALFRPTPKTNAA
GSRPHTTAITNDHRTTSHPYPHKDVVTSISSVTANPVTKGHKKKKSGIFVRNAGSDGDSF
PHVTATGPTTRPYIYEPRK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min