Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855532, SRP1

Organisms

Yeast (4932)

Synonyms

YNL189W;
KAP60|SCM1;
Srp1p

Description

Karyopherin alpha homolog, forms a dimer with karyopherin beta Kap95p to mediate import of nuclear proteins, binds the nuclear localization signal of the substrate during import; may also play a role in regulation of protein degradation

Xrefs

SGD:S000005133

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855532 PMID: 11283351
853091 855532 PMID: 16554755

Sequence Information

Nucleotide sequence

>855532 : length: 1629
atggataatggtacagattcttccacgagcaagttcgttcccgaatatagacgaacaaac
tttaagaataaaggcagattctctgcagatgaacttcgtcgtcgtagagatacacaacag
gtcgaattaagaaaagcaaaaagagatgaagctttggccaaaagaagaaactttattccc
ccaactgatggcgctgattctgatgaagaagatgagagctccgtttctgcggaccaacaa
ttttacagccagttgcagcaagaactaccacaaatgactcagcaacttaactctgatgat
atgcaagagcaattgagtgctactgttaagtttagacaaattttgtctagagaacaccgc
cctccaattgatgtcgtcattcaagccggtgttgttccaagattagtagaatttatgcgt
gaaaaccaacctgaaatgttacaattggaggctgcttgggctttgactaacattgcatca
ggtacatctgctcaaacaaaagtggttgttgatgctgacgctgtacctcttttcattcaa
ctattatataccggctccgttgaagttaaagaacaagccatttgggccttaggtaacgtt
gcaggtgattcaactgactacagagactacgttttacaatgtaatgccatggagccaatt
ttgggtctttttaactccaataaaccatctttgatcaggaccgctacgtggactttatcc
aatttatgcaggggtaaaaaaccacaaccagattggtcagtggtctcacaagcgttgcca
accttagcgaaattaatctattcgatggacactgaaactttagttgatgcttgttgggct
atctcttatctatctgacggaccacaagaagctattcaagcagtgatcgatgttagaatt
cctaaaagacttgttgaattactgagccatgaatcgactttagtccagactcctgcttta
agagctgtaggtaatatagtcactggtaatgacttacagactcaggtcgttataaatgct
ggtgtcttacctgcgttaagacttctgctaagctctccaaaagaaaatatcaagaaagaa
gcgtgttggaccatttccaatattacggctggtaatactgaacaaattcaagcggtaatt
gacgcgaacttgattcctccattagttaaacttttggaagttgcagaatataaaactaaa
aaagaagcttgttgggctatttccaatgcctcttcaggtggtttacaaagaccagatatc
ataagatatttagtatctcaagggtgtataaaaccattgtgtgatttgctagaaattgct
gacaacagaataattgaagttaccttagatgctcttgaaaatattttaaagatgggtgaa
gctgacaaagaagctcgtggtttgaatatcaatgaaaatgccgattttatcgaaaaggct
ggtggtatggaaaagattttcaactgtcaacaaaatgaaaatgacaagatttatgaaaaa
gcatacaaaatcattgaaacctactttggtgaagaagaagacgccgtagacgaaactatg
gctccacaaaatgccggtaatactttcggctttggttctaatgtcaaccaacaattcaat
tttaactaa

Protein sequence

>855532 : length: 542
MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIP
PTDGADSDEEDESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHR
PPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQ
LLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLS
NLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRI
PKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKE
ACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDI
IRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKA
GGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFN
FN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min