Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855543, RPS3

Organisms

Yeast (4932)

Synonyms

YNL178W;
SUF14;
Rps3p

Description

Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins

Xrefs

SGD:S000005122

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 855543 PMID: 17200106

Sequence Information

Nucleotide sequence

>855543 : length: 723
atggtcgctttaatctctaagaaaagaaagctagtcgctgacggtgtcttctacgctgaa
ttgaacgaattcttcaccagagaattagctgaagaaggttactccggtgttgaagtccgt
gtcactccaaccaagaccgaagttatcatcagagctaccagaactcaagatgttttgggt
gaaaacggtagaagaatcaacgaattaactttgttggttcaaaagagattcaagtacgct
ccaggtactattgtcttatatgctgaaagagttcaagaccgtggtttgtccgctgtcgct
caagctgaatctatgaaattcaaattgttgaacggtttggctatcagaagagctgcttac
ggtgtcgtcagatacgttatggaatctggtgctaagggttgtgaagttgttgtttccggt
aaactaagagctgccagagctaaggctatgaaatttgctgacggtttcttgattcactct
ggtcaaccagtcaacgacttcattgacactgctactagacacgtcttgatgagacaaggt
gttttgggtatcaaggttaagattatgagagacccagctaagagcagaactggtccaaag
gctttgccagatgctgtcaccatcattgaaccaaaagaagaagaaccaattcttgctcca
tctgtcaaggactacagaccagctgaagaaactgaagctcaagctgaaccagttgaagct
tag

Protein sequence

>855543 : length: 240
MVALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLG
ENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAY
GVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQG
VLGIKVKIMRDPAKSRTGPKALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min