Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855547, NOP13

Organisms

Yeast (4932)

Synonyms

YNL175C;
Protein of unknown function, localizes to the nucleolus and nucleoplasm; contains an RNA recognition motif (RRM) and has similarity to Nop12p, which is required for processing of pre-18S rRNA

Description

Nop13p

Xrefs

SGD:S000005119

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855547 PMID: 11805837
851152 855547 PMID: 11805837

Sequence Information

Nucleotide sequence

>855547 : length: 1212
atgtcagaaacagaactgtcgaaagaagatgctgttacaaaaaaggataacgaggaacaa
gtcaagaaggctttactcgatccaacaaaaaagagaaaagctgaagatgaaattgagatt
gacctgaaaagctccattcccctatcaaaaaaacagaaacgtctcttgagaagaggtaaa
gttactctagaggagttgaatgcgaagtacaatatcgaccctaagtcaatcgaggaatac
aaagaagatgctgaaaagaaaaagtctggtgcttctgagaaagacgcccagggtgaagaa
tctacaatcaacactccaacaggagatgaatctggcgaggttgtaaaaaagaagaagaaa
gatgaaaataaatatggtgtttggattggtaacttatccttcgacaccacaaaggacgat
ttagtaagattttttattgctaaaacaaaagacaacgaagatgaaaagagcagagtcacc
gaacaagacataaccaggttatccatgcctcgtgttgctgccaagaactctaacgccatg
aaaaataagggattttgctacatgtttttcaagaacgtcgagcagatgaaagcggtctta
gaattatctgaatctcatttaaacggaaggaatatgctaatcaaggactccgaaaattat
tcaggtaggccagacaaggacgatttagttgccatgtccaaaaatccaccgtcaaggatt
ctatttgtcggtaatttgtcattcgatgtcacagatgatctgttaagaaaacacttccaa
cattgtggtgatatcgtgaaaatccgcatggcaacattcgaagatagtggtaaatgtaaa
ggattcgcatttatcgacttcaagaatgaagaaggatctactaatgaattaaaggataaa
agttgtagaaaaattgccggaaggccattgcgaatggaatacggtgaagatagaagtaaa
agacaagttcgtaagaaggttgaaaatgtatccagaaacaattcctcatcatttgatatc
tctaacaacaaaggatacgatcgtgcgggacaggataacggcagcaaacccgaatacaag
cggtccaacgccaacagacgtccacctgtagattccaataaccgaactaagagcagtgta
gctttagccactgctcagagaggttctgcagctattgtcccatcacaaggtaagaaagtg
aagtttgactaa

Protein sequence

>855547 : length: 403
MSETELSKEDAVTKKDNEEQVKKALLDPTKKRKAEDEIEIDLKSSIPLSKKQKRLLRRGK
VTLEELNAKYNIDPKSIEEYKEDAEKKKSGASEKDAQGEESTINTPTGDESGEVVKKKKK
DENKYGVWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAM
KNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRI
LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK
SCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRNNSSSFDISNNKGYDRAGQDNGSKPEYK
RSNANRRPPVDSNNRTKSSVALATAQRGSAAIVPSQGKKVKFD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min