Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855658, RPL9B

Organisms

Yeast (4932)

Synonyms

YNL067W;
Rpl9bp

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Ap and has similarity to E. coli L6 and rat L9 ribosomal proteins

Xrefs

SGD:S000005011

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 855658 PMID: 16554755

Sequence Information

Nucleotide sequence

>855658 : length: 576
atgaagtacattcaaaccgaacaacaaattgaaatcccagaaggtgttactgtcagcatt
aagtccagaatcgtcaaggttgtcggtccaagaggtactttgaccaagaacttgaagcat
attgatgttaccttcaccaaggtcaacaaccaattgatcaaggttgctgttcacaacggt
gacagaaagcacgttgccgctttgagaaccgttaaatctttggttgacaacatgatcact
ggtgtcaccaagggttacaagtacaagatgagatacgtctacgcgcatttcccaatcaac
gtcaacattgttgaaaaggatggtgctaaattcattgaagtcagaaactttttgggtgac
aagaagatcagaaacgtcccagttagagatggtgttactatcgaattctctactaacgta
aaggacgaaatcgtcttatctggtaactctgttgaagacgtttcccaaaatgccgctgac
ttgcaacaaatctgtcgtgttagaaacaaggatatccgtaagtttttggatggtatctac
gtttcccacaagggtttcattgtcgaagacatgtaa

Protein sequence

>855658 : length: 191
MKYIQTEQQIEIPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNNQLIKVAVHNG
DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPINVNIVEKDGAKFIEVRNFLGD
KKIRNVPVRDGVTIEFSTNVKDEIVLSGNSVEDVSQNAADLQQICRVRNKDIRKFLDGIY
VSHKGFIVEDM



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min