Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855708, FAP1

Organisms

Yeast (4932)

Synonyms

YNL023C;
Protein that binds to Fpr1p (FKBP12), conferring rapamycin resistance by competing with rapamycin for Fpr1p binding; has similarity to putative transcription factors, including D. melanogaster shuttle craft and human NFX1

Description

Fap1p

Xrefs

SGD:S000004968

Chromosome

XIV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 855708 PMID: 16429126

Sequence Information

Nucleotide sequence

>855708 : length: 2898
atgaccgaacatgagtctttaggcctggagcaaaatcaagacggcggtgacacttataga
catcacaacctaagcgatgggtgtatttcgagtgttgaagacgccaacgagcagcctagt
tcgtatgaagaggaaagtgatgatgatatgcaatattacgaacgtgcgatccaggaaatt
tctagcggtgactcatatgtttgtatgatttgtacagtagagatggattatacgtgccaa
atgtttgcttgcaagagatgttatagagtgtttgattacggatgcataagagaatgggcg
ttaaaatcaacggaaaaaaccgtagatagaatatggaaatgtccaaactgctattatgtt
agcaaaagagttccggtaaaaaatcggcccacatgttggtgcggtaaagttgttaatcct
gatccgaatccgctggatcctaactcatgtggacaaacctgcaatgcttctacttgtatg
catggttgttccaaaatttgtcatctagggccgcatccagagtgtactagaatggtcgag
attatgtgccactgtggtaagcattcgaaaagtatcttttgttaccagtctaaagttatg
aaaaaaaacttcaactgtcaagaagtatgtggattgcctttatcttgctccatccacacc
tgtaaaaagaaatgccaccctggcttatgtgggccatgtccagaaatgataattagtaaa
gatagtccgaaaaagcaaataaaatgctactgtggtaaccacactcgtgctaacataaag
tgtagtgaaacaaagtttcccaagtccggtaagtcgtcgaaggatgaaaatgggaacagg
tggataggcgtgtttgcctgtgcagataatagagttgtcgactactcatgtcgcaagcat
tcattcatagaatcttgcataagcccacccacaattaatggagaaaaggcatgcccattt
ttgcctagctctttgaaaacttgtccctgtggccggacagccctagaggaactgactaag
cctcgtaagcattgtgatgatccgataccaacctgcgactcaagatgcggtaaaccacta
aaatgtggcaaacattcgtgccccttcacttgtcatgataaagcctgtatggaaccctgc
ttgcaaattgatagtgtaaaatgtgcttgtgagcaaagtacattttcagttccatgtgga
tttcaaggaaggcctcgctgcaatattaaatgcgaatccctgatgtcatgccgtagacat
agatgcaccgataggtgctgcagtggtaggccatcggcgataagaaggaagaaaaacttg
ttcagaacgcaagatttgttggatgagtctcttgtggaagcaaaacatatctgcctaaaa
ccgtgtaacttgaccctatcatgtggaattcataaatgtcagagaaaatgtcacccagga
aagtgtccgccctgtttagagagtgattcgaacgatctggtctgcccatgtggcaataca
gttgttcctgcacccgtgcgttgtggcacgaagctacctacatgtaatcatccatgtatt
aaagttgtgcgtggcgaatctacgtgtggtcataaaccaatgccacatacctgtcattcc
ttggatgtgtcgtgcccgccatgtacggaaaccgtatttaaaccttgtaaatgtgggaag
aaaactaaagtgagaacggtttgttttcaaacagacgtatcatgtggaataaaatgtggg
ataccactctcttactgttatcatacctgccaaaaaacatgtcatttaccaggaaattgc
caaaaggtgtgtaaacagacctgtgggcaaaaaaggctcaattgtaatcatgaatgtcct
aaaccgtgccatggtaagacagagtgtcccgatttaccttgtgccacgctagtgaaaatt
tattgtaaatgtggaaggatcaaaaaaagtgttacttgtggcgcaaaaagtgatagagta
agtgtaactgaatcttccgtgctggattgcaatgaagaatgtgaagctttgaaacgacta
aaggaattgaaggaggcatttggaattaaggaagaaaccaataattttacaagtaatgaa
ctagatgcgttaaaaaaactggtctctgttgctacaacatttgaagaactgcagttaccg
tttacagaggcagcattatcagtatattcaaagcaagaaagatggtgttcacaaattgaa
gctattcttaataaattaatggacgataaaacacgttcaagcttgcatttcaaacctatg
aggcctcctcaacgccacttcatccgtgaactagccaaagcttacggcctatattccgag
tctcaggacagagagcccatgagatctgtatttattaagaaagaagataatggcgcaagc
aataaaccagtcttatcattagcagaagcttacccactatatgaatcatttaaacaattg
cagaaggaaaggaaagcacaagaatttcaagctcgcaccacagctaaactaatcaacttc
gaggttcaagatacggaacctaaagtagaggtggctaagaaaaatggttttttggttcaa
aatttggttgctggaaatactgccgaagatctaaggagattttttgaaccacatctcaag
catacgttagtagtgaatcctcaatacctaatccttgatgatggcaaaacagcactagtg
tatcctgaaaattacgaaacagcatccgtgaataccgaacgtgacatggagcttttggtt
ggacacttcgattttatggccaaagaggcatttttggccgattccatttcgttgtgttca
actgaagaagaacttgaaagaaggttggatacgcccgtaattcaagaggatagtcctgta
atggataataatacatga

Protein sequence

>855708 : length: 965
MTEHESLGLEQNQDGGDTYRHHNLSDGCISSVEDANEQPSSYEEESDDDMQYYERAIQEI
SSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVDRIWKCPNCYYV
SKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHLGPHPECTRMVE
IMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGLCGPCPEMIISK
DSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACADNRVVDYSCRKH
SFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPIPTCDSRCGKPL
KCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRH
RCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPG
KCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTCGHKPMPHTCHS
LDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHTCQKTCHLPGNC
QKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKKSVTCGAKSDRV
SVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVSVATTFEELQLP
FTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSE
SQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEFQARTTAKLINF
EVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQYLILDDGKTALV
YPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRLDTPVIQEDSPV
MDNNT



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min