Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855819, CLN2

Organisms

Yeast (4932)

Synonyms

YPL256C;
G1 cyclin involved in regulation of the cell cycle; activates Cdc28p kinase to promote the G1 to S phase transition; late G1 specific expression depends on transcription factor complexes, MBF (Swi6p-Mbp1p) and SBF (Swi6p-Swi4p)

Description

Cln2p

Xrefs

SGD:S000006177

Chromosome

XVI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 855819 PMID: 16319894

Sequence Information

Nucleotide sequence

>855819 : length: 1638
atggctagtgctgaaccaagaccccgtatgggactcgtcatcaatgctaaaccggactac
tatccgattgagctatctaatgcagaattactttctcacttcgaaatgctgcaagaatac
caccaagaaatctccaccaatgttattgctcaatcatgtaagttcaaacctaatccaaaa
ctaatagaccagcagcctgaaatgaaccccgtggaaacaaggtccaacattatcactttt
ttgttcgagctgtctgtggtcactcgagtgacaaatggtattttttttcattcagttaga
ttatatgaccgctattgttccaagagaatcgtgttacgggaccaagccaaattggttgtc
gctacttgtctctggttggctgctaaaacttggggcggttgtaatcacatcatcaataat
gtagtcatccctactggcggaagattttatggtcccaacccaagggcacgtatacctcga
ctctctgaactagttcattactgtggtgatggtcaggtctttgatgaatcaatgttttta
caaatggaaagacatatactagacactttaaattggaacatttatgaaccaatgatcaat
gattacgttttaaatgttgatgaaaattgtttgatgcaatacgaactttatgaaaatcaa
gttacttatgacaaacaatgctctgaaaaacgtcagtctcaattatcccaggatagtgat
gccactgtagacgagaggccctaccaaaacgaagaagaagaagaagaagacttaaaacta
aagatcaagttgattaatttgaaaaaattcttgattgatgtatccgcgtggcagtacgac
ttacttagatatgaacttttcgaagtatcgcacggcatattctccattatcaatcaattc
accaatcaagaccacggtccttttttaatgactccaatgacatcagaaagcaaaaatggt
gaaattttgagtaccttaatgaacggcattgtttccattcctaactccttgatggaagtg
tataaaacggtcaatggtgttctacccttcattaatcaagtgaaagaatatcacttggat
ctacaaagaaaactgcaaattgcatccaacttgaacatttcgagaaagcttaccatatca
accccatcatgctctttcgaaaattcaaatagcacatccattccttcgcccgcttcctca
tctcaaagccacactccaatgagaaacatgagctcactctctgataacagcgttttcagc
cggaatatggaacaatcatcaccaatcactccaagtatgtaccaatttggtcagcagcag
tcaaacagtatatgtggtagcaccgttagtgtgaatagtctggtgaatacaaataacaaa
caaaggatctacgaacaaatcacgggtcctaacagcaataacgcaaccaatgattatatt
gatttgctaaacctaaatgagtctaacaaggaaaaccaaaatcccgcaacggcgcattac
ctcaatgggggcccacccaagacaagcttcattaaccatggaatgttcccctcgccaact
gggaccataaatagcggtaaatctagcagtgcctcatctttaatttcttttggtatgggc
aatacccaagtaatatag

Protein sequence

>855819 : length: 545
MASAEPRPRMGLVINAKPDYYPIELSNAELLSHFEMLQEYHQEISTNVIAQSCKFKPNPK
LIDQQPEMNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYDRYCSKRIVLRDQAKLVV
ATCLWLAAKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYCGDGQVFDESMFL
QMERHILDTLNWNIYEPMINDYVLNVDENCLMQYELYENQVTYDKQCSEKRQSQLSQDSD
ATVDERPYQNEEEEEEDLKLKIKLINLKKFLIDVSAWQYDLLRYELFEVSHGIFSIINQF
TNQDHGPFLMTPMTSESKNGEILSTLMNGIVSIPNSLMEVYKTVNGVLPFINQVKEYHLD
LQRKLQIASNLNISRKLTISTPSCSFENSNSTSIPSPASSSQSHTPMRNMSSLSDNSVFS
RNMEQSSPITPSMYQFGQQQSNSICGSTVSVNSLVNTNNKQRIYEQITGPNSNNATNDYI
DLLNLNESNKENQNPATAHYLNGGPPKTSFINHGMFPSPTGTINSGKSSSASSLISFGMG
NTQVI



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min