Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855881, RPL1A

Organisms

Yeast (4932)

Synonyms

YPL220W;
SSM1;
Rpl1ap

Description

N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl1Bp and has similarity to E. coli L1 and rat L10a ribosomal proteins; rpl1a rpl1b double null mutation is lethal

Xrefs

SGD:S000006141

Chromosome

XVI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 855881 PMID: 16429126
851152 855881 PMID: 16554755

Sequence Information

Nucleotide sequence

>855881 : length: 654
atgtccaagatcacttcttctcaagtcagagaacacgtcaaggaattgttgaagtattcc
aacgaaaccaagaagagaaacttcttggaaaccgtcgaactacaagtcggtttgaagaac
tatgaccctcaaagagacaagcgtttctctggttctttgaagttgccaaattgtccaaga
ccaaacatgtccatctgtatcttcggtgatgctttcgatgttgacagagctaagtcttgc
ggtgttgacgctatgtccgtcgatgacttgaagaagttgaacaagaacaagaagttaatc
aagaagttgtctaagaagtacaacgctttcattgcttctgaagttttgatcaagcaagtt
ccaagactattgggtcctcaattgtccaaggctggtaagttcccaaccccagtttctcac
aacgatgacttgtacggtaaggtcactgatgtcagatctaccatcaagttccaattgaag
aaggtcttgtgtttggctgttgccgttggtaacgttgaaatggaagaagacgttttggtt
aaccaaatcttgatgtctgttaacttctttgtttctttgttgaagaagaactggcaaaat
gttggttccttggttgttaagtcctccatgggtccagctttcagattgtactaa

Protein sequence

>855881 : length: 217
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPR
PNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQV
PRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLV
NQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min