Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855903, RPL7B

Organisms

Yeast (4932)

Synonyms

YPL198W;
Rpl7bp

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Ap and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)

Xrefs

SGD:S000006119| SGD:S000006450

Chromosome

XVI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 855903 PMID: 16429126
854948 855903 PMID: 17200106
851152 855903 PMID: 16429126
851152 855903 PMID: 17200106

Sequence Information

Nucleotide sequence

>855903 : length: 735
atgtccactgaaaaaatcttgactcctgaatctcaattgaagaagactaaagctcaacaa
aagactgcagaacaaattgctgcagagagagctgcccgtaaagccgctaacaaggaaaaa
agagctattattttggaaagaaacgccgcttaccaaaaggaatacgaaactgctgaaaga
aacatcattcaagctaagcgtgatgccaaggctgctggttcctactacgtcgaagctcaa
cacaagttggtcttcgttgtcagaatcaagggtattaacaagattccacctaagccaaga
aaggttctacaattgctaagattgacaagaatcaactctggtacattcgtcaaagttacc
aaggctactttggaactattgaagttgattgaaccatacgttgcttacggttacccatcc
tactctactattagacaattggtctacaagagaggtttcggtaagatcaacaagcaaaga
gttccattgtccgacaatgctatcatcgaagccaacttgggtaagtatggtatcttgtcc
attgacgatttgattcacgaaatcatcactgttggtccacacttcaagcaagctaacaac
tttttgtggccattcaagttgtccaacccatctggtggttggggtgtcccaagaaagttc
aagcatttcatccaaggtggttctttcggtaaccgtgaagaattcatcaataaattggtt
aaggctatgaactaa

Protein sequence

>855903 : length: 244
MSTEKILTPESQLKKTKAQQKTAEQIAAERAARKAANKEKRAIILERNAAYQKEYETAER
NIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVT
KATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILS
IDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLV
KAMN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min