Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

855972, RPL5

Organisms

Yeast (4932)

Synonyms

YPL131W;
LPI14|RPL1;
Rpl5p

Description

Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly

Xrefs

SGD:S000006052

Chromosome

XVI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 855972 PMID: 16429126
851152 855972 PMID: 17200106

Sequence Information

Nucleotide sequence

>855972 : length: 894
atggctttccaaaaagacgctaagtcctctgcttactcctctcgtttccaaactcctttc
agaagaagaagagaaggtaagactgattactaccaaagaaagagattggtcacccaacac
aaggccaagtacaacactccaaagtacagattggttgttagattcactaacaaggatatc
atctgtcaaatcatctcttctaccatcactggtgatgtcgtcttagctgctgcctactcc
cacgaattgccaagatacggtattacccacggtttgaccaactgggctgctgcttacgct
actggtttgttgatcgccagaagaaccttgcaaaagttgggtttggacgaaacttacaag
ggtgttgaagaagttgaaggtgaatacgaattgaccgaagctgttgaagatggtccacgt
ccattcaaggtcttcttggatattggtttgcaaagaaccaccactggtgccagagttttc
ggtgctctaaagggtgcttctgacggtggtttgtacgttcctcactccgaaaacagattc
ccaggttgggacttcgaaaccgaagaaattgacccagaattattgagatcttacatcttt
ggtggccacgtttcccaatacatggaagaattagctgacgatgatgaagaaagattctct
gaattattcaagggttacctagctgacgacattgatgctgactctttggaagacatctac
acttctgctcacgaagctatcagagctgacccagctttcaagccaactgaaaagaaattc
accaaggaacaatacgctgctgaatccaagaagtacagacaaaccaaattgtccaaggaa
gaaagagctgctcgtgttgctgccaagatcgctgctttggctggtcaacaataa

Protein sequence

>855972 : length: 297
MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI
ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK
GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min