Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856305, DPB2

Organisms

Yeast (4932)

Synonyms

YPR175W;
Second largest subunit of DNA polymerase II (DNA polymerase epsilon), required for normal yeast chromosomal replication; expression peaks at the G1/S phase boundary; potential Cdc28p substrate

Description

Dpb2p

Xrefs

SGD:S000006379

Chromosome

XVI : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 856305 PMID: 16429126
851152 856305 PMID: 16554755

Sequence Information

Nucleotide sequence

>856305 : length: 2070
atgtttggctctgggaatgttctgcctgttaaaattcagcctccgctgcttaggccactg
gcgtatagagttttatcaagaaaatatggtttatcaattaaatctgatggactgtctgct
cttgcagaattcgttggcactaatataggtgctaactggagacaagggcctgctacaata
aaatttctcgagcaatttgctgcagtatggaaacaacaagaaagaggccttttcatcgac
cagagcggggttaaagaagttatacaggagatgaaagaacgtgagaaagtcgaatggagt
catgaacaccctattcaacatgaggagaatatcttgggacggacagatgacgatgagaac
aacagtgacgatgaaatgccgatcgctgctgattcatccttacaaaatgtttcattatct
tcacccatgcgacagcccaccgaaagagatgaatataaacagcctttcaagccagaaagc
tccaaggcgttggactggagggactacttcaaagttatcaatgcttctcagcaacaaaga
ttctcatacaatccgcacaaaatgcaatttattttcgtccccaataaaaagcagaatggg
ctaggaggcattgcgggttttctaccagatatagaggacaaagttcaaatgttcttgaca
agatattacctcacgaacgacagagtcatgagaaatgaaaacttccaaaacagtgacatg
tttaatccattatcatctatggtgtctttacaaaatgaactgtccaatactaaccgacag
cagcaatccagcagtatgagtatcaccccaataaaaaacctactaggtagggatgctcaa
aactttctactattggggctcttaaataagaactttaagggcaattggtcactggaagat
ccgtctggatctgtcgaaattgacatttcccaaactatccctacacaaggccattactac
gtgccaggttgcatggttcttgtggaaggaatatactattctgtaggaaataaattccat
gttacctccatgactttaccccctggtgagagaagagaaattacattagaaacgataggt
aatctcgatctcttaggaatacatggcatttctaataacaatttcattgctcgtttggat
aaagatttgaagattagattacaccttttggagaaagaattaacagatcataaatttgta
attctcggcgcaaatttgttcctagatgatttgaaaattatgactgcactcagcaaaatt
ttgcaaaaattaaatgatgacccaccgaccctattaatttggcaaggttctttcacttca
gttcccgttttcgcatcaatgagtagccggaatataagtagttccactcaatttaagaat
aatttcgatgccttggcgacgcttctgtcaagatttgacaatttgaccgaaaataccaca
atgatatttattccaggtcctaacgatttatgggggtcgatggtgtcattgggggcaagt
gggacattaccgcaagatccaattcctagtgcgtttaccaaaaaaatcaacaaggtctgt
aaaaacgttgtatggagctcaaatccaactagaatagcatacttatcccaagaaatagtc
attttcagggacgatttatccggaagattcaaaagacaccgtttggaattcccattcaac
gagagcgaagatgtttatactgaaaacgataacatgatgtctaaagacaccgatattgta
ccaatcgatgaattagttaaagaaccagaccagttaccacaaaaggttcaagaaacaaga
aaactcgttaaaacaatactagaccagggtcatttatcgccatttcttgattccttgcgc
ccaatttcatgggatttggaccacactttgacactttgcccaataccatcgacaatggtt
ctttgcgacactacttctgcacaatttgatttgacatacaacggttgtaaagtaattaac
cctggaagtttcattcataatagacgtgctaggtatatggagtacgttccatcctcaaag
aaaactatacaagaagagatatatatctaa

Protein sequence

>856305 : length: 689
MFGSGNVLPVKIQPPLLRPLAYRVLSRKYGLSIKSDGLSALAEFVGTNIGANWRQGPATI
KFLEQFAAVWKQQERGLFIDQSGVKEVIQEMKEREKVEWSHEHPIQHEENILGRTDDDEN
NSDDEMPIAADSSLQNVSLSSPMRQPTERDEYKQPFKPESSKALDWRDYFKVINASQQQR
FSYNPHKMQFIFVPNKKQNGLGGIAGFLPDIEDKVQMFLTRYYLTNDRVMRNENFQNSDM
FNPLSSMVSLQNELSNTNRQQQSSSMSITPIKNLLGRDAQNFLLLGLLNKNFKGNWSLED
PSGSVEIDISQTIPTQGHYYVPGCMVLVEGIYYSVGNKFHVTSMTLPPGERREITLETIG
NLDLLGIHGISNNNFIARLDKDLKIRLHLLEKELTDHKFVILGANLFLDDLKIMTALSKI
LQKLNDDPPTLLIWQGSFTSVPVFASMSSRNISSSTQFKNNFDALATLLSRFDNLTENTT
MIFIPGPNDLWGSMVSLGASGTLPQDPIPSAFTKKINKVCKNVVWSSNPTRIAYLSQEIV
IFRDDLSGRFKRHRLEFPFNESEDVYTENDNMMSKDTDIVPIDELVKEPDQLPQKVQETR
KLVKTILDQGHLSPFLDSLRPISWDLDHTLTLCPIPSTMVLCDTTSAQFDLTYNGCKVIN
PGSFIHNRRARYMEYVPSSKKTIQEEIYI



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min