Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856351, SBP1

Organisms

Yeast (4932)

Synonyms

YHL034C;
SSB1|SSBR1;
Sbp1p

Description

Putative RNA binding protein; involved in translational repression and found in cytoplasmic P bodies; found associated with small nucleolar RNAs snR10 and snR11

Xrefs

SGD:S000001026

Chromosome

VIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 856351 PMID: 16429126
851152 856351 PMID: 17456744

Sequence Information

Nucleotide sequence

>856351 : length: 885
atgtctgctgaaattgaagaagctactaatgccgtaaacaacttgagcatcaacgactcc
gaacagcaaccaagggctcctactcataagacagtaattgaccccgaggacacaatcttt
attggtaatgttgctcacgaatgtaccgaagacgacttgaagcaattgtttgtggaggaa
ttcggggatgaagtcagcgtagagatcccaattaaggaacacaccgacggtcacattcca
gctagtaaacacgctctagtcaagttcccaaccaagattgattttgataatatcaaggag
aattatgacacgaaagtcgttaaggacagagaaattcatattaagagagctagaactcca
ggccaaatgcaaagaggaggtttcagaggcagaggcggtttcagaggcagaggaggtttt
agaggaggtttcagaggcggctacagaggaggtttcagaggcagagggaacttcagaggt
agaggcggcgccagaggtggtttcaatggacaaaaaagggaaaagattccattagaccaa
atggaaagatcaaaggataccttatatattaataacgtcccattcaaagctaccaaagag
gaggtcgctgaatttttcggtactgacgccgactccatctctttgccaatgagaaaaatg
agagaccaacacactggtaggatcttcacatccgattctgctaatagaggtatggcattt
gtcactttcagtggtgaaaacgttgatattgaagctaaagctgaagaatttaaaggcaag
gttttcggtgacagggagttaactgtagatgttgctgttattagaccagaaaatgatgaa
gaagaaattgagcaagaaactggttctgaagaaaagcaagaataa

Protein sequence

>856351 : length: 294
MSAEIEEATNAVNNLSINDSEQQPRAPTHKTVIDPEDTIFIGNVAHECTEDDLKQLFVEE
FGDEVSVEIPIKEHTDGHIPASKHALVKFPTKIDFDNIKENYDTKVVKDREIHIKRARTP
GQMQRGGFRGRGGFRGRGGFRGGFRGGYRGGFRGRGNFRGRGGARGGFNGQKREKIPLDQ
MERSKDTLYINNVPFKATKEEVAEFFGTDADSISLPMRKMRDQHTGRIFTSDSANRGMAF
VTFSGENVDIEAKAEEFKGKVFGDRELTVDVAVIRPENDEEEIEQETGSEEKQE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min