Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856572, THP2

Organisms

Yeast (4932)

Synonyms

YHR167W;
Thp2p

Description

Subunit of the THO complex, which connects transcription elongation and mitotic recombination, and of the TREX complex, which is recruited to activated genes and couples transcription to mRNA export; involved in telomere maintenance

Xrefs

SGD:S000001210

Chromosome

VIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 856572 PMID: 16429126

Sequence Information

Nucleotide sequence

>856572 : length: 786
atgacaaaggaagaaggtcgtacgtattttgaatctctctgcgaggaggaacaaagtttg
caggaaagccaaacccacttattaaatattttagatatattatcagtattggcagaccct
agatcatctgatgatctgcttactgaatccctcaagaagttgcctgatttacacagggag
ctgataaatagttccatccgcctgcgatacgataaatatcaaacaagagaagcacagctt
ttggaggatacaaaaactggaagggacgttgcagcgggagtacagaatcctaagagtatt
agcgagtactattctactttcgaacatttgaatagggatactttaaggtacataaattta
ctgaagcgactttctgttgatttagcaaagcaggtggaagtgtctgatccatcagtgaca
gtgtatgaaatggataaatgggttccatctgagaaacttcagggtattctcgagcagtac
tgtgcgcctgatactgatatacgtggtgtagacgctcaaatcaagaactatctagatcag
atcaaaatggcacgtgccaaatttggtttagagaataagtattccttaaaggaaagactc
tctactttgacaaaggaactaaaccattggcgaaaagaatgggacgatatagaaatgctt
atgttcggtgatgatgcacattctatgaaaaaaatgatccagaagatagattcattaaag
tctgaaataaatgctccatcggaaagctatcctgtagataaagaaggtgacatagtttta
gaataa

Protein sequence

>856572 : length: 261
MTKEEGRTYFESLCEEEQSLQESQTHLLNILDILSVLADPRSSDDLLTESLKKLPDLHRE
LINSSIRLRYDKYQTREAQLLEDTKTGRDVAAGVQNPKSISEYYSTFEHLNRDTLRYINL
LKRLSVDLAKQVEVSDPSVTVYEMDKWVPSEKLQGILEQYCAPDTDIRGVDAQIKNYLDQ
IKMARAKFGLENKYSLKERLSTLTKELNHWRKEWDDIEMLMFGDDAHSMKKMIQKIDSLK
SEINAPSESYPVDKEGDIVLE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min