Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856610, RPS4B

Organisms

Yeast (4932)

Synonyms

YHR203C;
Rps4bp

Description

Protein component of the small (40S) ribosomal subunit; identical to Rps4Ap and has similarity to rat S4 ribosomal protein

Xrefs

SGD:S000001246

Chromosome

VIII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 856610 PMID: 17200106
851152 856610 PMID: 17200106

Sequence Information

Nucleotide sequence

>856610 : length: 786
atggctagaggaccaaagaagcatctaaagagattagcagctccacaccattggttattg
gacaagttgtccggttgttacgccccaagaccatctgctggtccacacaaattgcgtgaa
tccttgccattgattgtctttctaagaaacagattaaagtatgctttgaacggccgtgaa
gtcaaggctatcttgatgcaacgtcacgtcaaagttgacggtaaggttagaactgacacc
acctacccagctggtttcatggacgtcatcactctagatgccaccaatgaaaacttcaga
ttggtctacgatgtcaagggtagattcgctgtccaccgtatcaccgatgaagaagcctct
tacaaattgggtaaggtcaagaaggtccaattaggtaagaagggtgttccatacgttgtt
acccacgatggtagaactatcagatacccagacccaaacatcaaggtcaatgacactgtt
aagattgatttggcctctggtaagattactgatttcatcaagttcgatgccggtaagttg
gtttacgttactggtggtcgtaacttgggtcgtatcggtactatcgttcacaaggaaaga
cacgatggtggtttcgatttggttcacatcaaggactccttggacaacactttcgtcact
agattgaacaatgtcttcgtcattggtgaacaaggtaagccttacatttctttgccaaag
ggtaagggtatcaagttgtctattgctgaagaacgtgacagaagaagagctcaacaaggt
ttgtaa

Protein sequence

>856610 : length: 261
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min