Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856776, RSM18

Organisms

Yeast (4932)

Synonyms

YER050C;
Rsm18p

Description

Mitochondrial ribosomal protein of the small subunit, has similarity to E. coli S18 ribosomal protein

Xrefs

SGD:S000000852

Chromosome

V : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 856776 PMID: 16554755
851152 856776 PMID: 16554755

Sequence Information

Nucleotide sequence

>856776 : length: 417
atgcaacctatcatcaagggagcagtaagctccacatttaaacgtgctctatacaatttc
ggtatcaaagaaaagaagagtgtcaatattgaaatggggagaacgcaacaaacaaagaaa
atcgatcagtctttgtccaaaaaacttcccaaaggtactatctacgatccatttgacttc
tctatgggacgaatccatttagatagaaaatatcaggcaaacaagaactcaaacaggaac
gatataatgaagtccggtgcaaatccactagaattttatgcaagaccaagaatactttca
agatatgtgacctccacgggaagaatccaacatagggatatcacaggcttatcggcaaag
aatcaaagaagactatcgaaagccattagacggtgccaggcaataggattaatgtga

Protein sequence

>856776 : length: 138
MQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYDPFDF
SMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAK
NQRRLSKAIRRCQAIGLM



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min