Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856885, MAG1

Organisms

Yeast (4932)

Synonyms

YER142C;
MMS5;
Mag1p

Description

3-methyl-adenine DNA glycosylase involved in protecting DNA against alkylating agents; initiates base excision repair by removing damaged bases to create abasic sites that are subsequently repaired

Xrefs

SGD:S000000944

Chromosome

V : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 856885 PMID: 11805837
854948 856885 PMID: 11805837
851152 856885 PMID: 11805837

Sequence Information

Nucleotide sequence

>856885 : length: 891
atgaaactaaaaagggagtatgatgagttaataaaagcagacgctgttaaggaaatagca
aaagaattagggtctcgacctctagaggttgctcttcctgagaaatatattgctagacat
gaagaaaagttcaatatggcttgcgaacacattttagagaaagatccatcactttttccc
atacttaagaataatgaatttacgttgtacttgaaggagactcaagtccctaatacactc
gaagattattttattaggcttgcaagcacaattttgtctcaacagatcagtggccaagca
gctgaaagcatcaaggcaagggttgtcagtctttatggcggtgcatttcctgattacaaa
atccttttcgaagacttcaaagacccagcaaaatgtgcagaaatcgcaaaatgtggattg
agtaaaaggaaaatgatatatctagagtctcttgctgtctattttactgaaaaatataag
gatatcgaaaagctcttcggtcaaaaagataatgatgaggaagtgattgaaagtttagtt
acgaatgtaaaaggtataggcccatggagtgccaaaatgttcttgatctccggattgaaa
agaatggatgtatttgctcctgaagatctaggtattgctaggggtttttcaaaatacctt
tcagataagccagaattggaaaaagaattaatgcgtgaaagaaaagtagttaaaaagagt
aagattaagcataagaaatacaactggaaaatatatgacgacgacataatggaaaaatgc
tctgaaacattttctccgtataggtctgtgtttatgttcatactttggaggctcgcgagc
acaaatacagatgccatgatgaaggcagaagaaaatttcgtgaaatcctaa

Protein sequence

>856885 : length: 296
MKLKREYDELIKADAVKEIAKELGSRPLEVALPEKYIARHEEKFNMACEHILEKDPSLFP
ILKNNEFTLYLKETQVPNTLEDYFIRLASTILSQQISGQAAESIKARVVSLYGGAFPDYK
ILFEDFKDPAKCAEIAKCGLSKRKMIYLESLAVYFTEKYKDIEKLFGQKDNDEEVIESLV
TNVKGIGPWSAKMFLISGLKRMDVFAPEDLGIARGFSKYLSDKPELEKELMRERKVVKKS
KIKHKKYNWKIYDDDIMEKCSETFSPYRSVFMFILWRLASTNTDAMMKAEENFVKS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min