Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856890, SCC4

Organisms

Yeast (4932)

Synonyms

YER147C;
Subunit of cohesin loading factor (Scc2p-Scc4p), a complex required for the loading of cohesin complexes onto chromosomes; involved in establishing sister chromatid cohesion during double-strand break repair via phosphorylated histone H2AX

Description

Scc4p

Xrefs

SGD:S000000949

Chromosome

V : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 856890 PMID: 16554755

Sequence Information

Nucleotide sequence

>856890 : length: 1875
atggaaaatcttggcgacaaacttagtatttcacaagtataccacttagcacaggaatac
agagaccatgcatattcaattgcgaataaaatcggttctgaggaagggttgaagcagtat
tatggcctcatgaacatgtctatccagatgtttcagctattgaaaacgaaatgtacgctt
tcagttctggaggatagtaaggtcacgtttgagatggtggagttattgatacaggagacg
tataattttgacctagcagagctttacatttccagtttgaaagaacggttacaaacgcac
cagagcgacacagatttggtagaagagatcatgcgttgcgagtttctgctgttacatgac
ttgccacttatgagagacagtaagttccactataagattgcactaagaaattgcaatgaa
ttagtccagtacatggtaaatttgcaggatgagttgtatcaaaattgggcatccgtattc
cagtatgtcggcgtgatgctttgcattaagctgaaacagcaccgcagggtgaagacgagt
tttcatgggctactctcgcaatgtcgggaaaagtcacaatggaaatggtttctaaatctg
tgttatgtgaattacttgctaaatgagaggttcccaatccccgaggatgctctgcaggag
ctgcgaagcacggagctgcacacggtggggcctgagctatatgcatggaagttggcatta
gagatggtaatccagctttgtaaagacgggaatattacggaccacttgaacgaattcaaa
aatttctttgacacaaacaagcaatctctagtcactaatgaaggtaagggatgtgtgatc
aaaatcatgccaaggatagcgctgaaagtagagttgcctatgattttccactacaaagaa
ttaaagaacatactgttattattgcaaagtgtcagctacatcgtgaactgttatgacgaa
aagggcaatttttccaggaagttcctccccaaagtctattctacaacgcagaaactgatt
aagaacattgccgctggcggtgtttcgatgaatgagctggactcacgaatccagacatac
aagagcattcttgaattctgtgagttttacaaagtgtgggaacaaacactcttgaagggg
gccgtagtgacgaccgagtcacctaagttagggccctctccaggctacgtgaggctgctg
caagccatgaaggttcagtttgaaggcggcggggccgtagaagagtacacgcggcttgca
caatctggcggtacatccagcgaggtgaagatgatatcgcttctgaattgctacacagtg
caggcggcaagagtgagccgatgttcgggggacaaacagggcgaactcgtagagcaatgc
aacaaggtgtggcttcaggtggagaaattgctacaagaaacggatctgcagttcaacccc
atatgggagtgcacagtaacgatcctatggcttttcagccatttcgagccgttcagttgg
aacccgctgccatgtagtgacaagcagcgcgccgagtacgtgtcgaagctccgcgagttc
tactctagcaacaagttcgttgccggagaagccgttgcggacaaccgcttcaaattgaag
aaggctctgttgctgcaaatactggtaaactacttaggcggtcgaatgctcgaacacgat
ctgggcgagatctatgcgatttcagcaaagtgtttcgatatgtgccgccagcagggcggc
atgcgcaaggtccaatacgtgatcggaatatggcatttaatgaattgtacggtggcgatg
cggggaaaagacgtcgctctcacgaacgcgaagctggaggcgctggttaagcaaatcacc
agtgtcaaacaataa

Protein sequence

>856890 : length: 624
MENLGDKLSISQVYHLAQEYRDHAYSIANKIGSEEGLKQYYGLMNMSIQMFQLLKTKCTL
SVLEDSKVTFEMVELLIQETYNFDLAELYISSLKERLQTHQSDTDLVEEIMRCEFLLLHD
LPLMRDSKFHYKIALRNCNELVQYMVNLQDELYQNWASVFQYVGVMLCIKLKQHRRVKTS
FHGLLSQCREKSQWKWFLNLCYVNYLLNERFPIPEDALQELRSTELHTVGPELYAWKLAL
EMVIQLCKDGNITDHLNEFKNFFDTNKQSLVTNEGKGCVIKIMPRIALKVELPMIFHYKE
LKNILLLLQSVSYIVNCYDEKGNFSRKFLPKVYSTTQKLIKNIAAGGVSMNELDSRIQTY
KSILEFCEFYKVWEQTLLKGAVVTTESPKLGPSPGYVRLLQAMKVQFEGGGAVEEYTRLA
QSGGTSSEVKMISLLNCYTVQAARVSRCSGDKQGELVEQCNKVWLQVEKLLQETDLQFNP
IWECTVTILWLFSHFEPFSWNPLPCSDKQRAEYVSKLREFYSSNKFVAGEAVADNRFKLK
KALLLQILVNYLGGRMLEHDLGEIYAISAKCFDMCRQQGGMRKVQYVIGIWHLMNCTVAM
RGKDVALTNAKLEALVKQITSVKQ



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min