Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856908, SPT2

Organisms

Yeast (4932)

Synonyms

YER161C;
EXA1|SIN1;
Spt2p

Description

Protein involved in negative regulation of transcription; required for RNA polyadenylation; exhibits regulated interactions with both histones and SWI-SNF components, has similarity to mammalian HMG1 proteins

Xrefs

SGD:S000000963

Chromosome

V : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

853288 856908 PMID: 2004420
856626 856908 PMID: 11805837

Sequence Information

Nucleotide sequence

>856908 : length: 1002
atgagttttctttccaaactttcccaaatacgaaaatcaacgactgcatcaaaagcccaa
gtgcaagatccattacccaagaagaatgacgaagagtattccttgttacccaaaaattac
ataagagacgaagatcctgcagtaaaaagattgaaggagctgaggcggcaggaactgtta
aagaatggtgctttggctaaaaaaagtggtgtaaaacggaaacgtggcacctcatctgga
tctgagaaaaagaaaatagaaaggaatgacgatgatgaaggtggccttggaattaggttt
aagaggtctattggagcaagtcatgcgccactcaagccagttgtaaggaagaaacctgaa
cctatcaaaaagatgtcatttgaagagctaatgaaacaagcggaaaataatgagaaacag
cccccaaaagttaagtcatcggaacccgtaactaaggaacgcccacattttaacaagcca
ggtttcaaaagttcaaaaagaccacaaaagaaagcatcccctggcgcaacattgcgtgga
gtatcttctggaggcaatagcataaaatcatcagactcacccaagcccgtcaagctcaac
ttgcccacaaatggatttgctcaacctaataggagattaaaagaaaagttagaatctaga
aaacagaaatcaagataccaggatgactatgatgaagaagataacgatatggatgatttt
atagaagacgatgaagatgaaggttaccacagcaaatcgaaacacagcaatggtcccgga
tatgatcgtgacgaaatttgggctatgttcaatagaggcaagaagcggtcagaatacgat
tacgatgagcttgaggatgatgatatggaagcaaatgagatggaaatcttggaagaggag
gaaatggcaagaaaaatggcaaggttagaggataaacgtgaggaagcttggttaaaaaag
catgaagaggagaagagacgccgtaagaagggcatacgctaa

Protein sequence

>856908 : length: 333
MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSLLPKNYIRDEDPAVKRLKELRRQELL
KNGALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPLKPVVRKKPE
PIKKMSFEELMKQAENNEKQPPKVKSSEPVTKERPHFNKPGFKSSKRPQKKASPGATLRG
VSSGGNSIKSSDSPKPVKLNLPTNGFAQPNRRLKEKLESRKQKSRYQDDYDEEDNDMDDF
IEDDEDEGYHSKSKHSNGPGYDRDEIWAMFNRGKKRSEYDYDELEDDDMEANEMEILEEE
EMARKMARLEDKREEAWLKKHEEEKRRRKKGIR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min