Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

856912, PAB1

Organisms

Yeast (4932)

Synonyms

YER165W;
Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G

Description

Pab1p

Xrefs

SGD:S000000967

Chromosome

V : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 856912 PMID: 16429126
851152 856912 PMID: 16429126

Sequence Information

Nucleotide sequence

>856912 : length: 1734
atggctgatattactgataagacagctgaacaattggaaaacttgaatattcaagatgac
caaaagcaagccgccactggttcagaaagccaatctgttgaaaactcttctgcatcatta
tatgttggtgacttagaaccttctgtttccgaagcccacttatatgatatcttctctcca
atcggttcagtctcctccattcgtgtctgtcgtgatgccatcactaagacctctttgggc
tatgcttatgttaactttaacgaccatgaagccggcagaaaagcaattgagcaattgaac
tacactccaatcaagggtagattatgccgtattatgtggtctcaacgtgacccatcattg
agaaagaagggttctggtaacatctttatcaagaacttgcaccctgatattgacaacaag
gctttgtatgacactttctctgtgtttggtgacatcttgtccagcaagattgccaccgac
gaaaacggaaaatccaagggttttgggtttgttcacttcgaagaagaaggtgctgccaag
gaagctattgatgctttgaatggtatgctgttgaacggtcaagaaatttatgttgctcct
cacttgtccagaaaggaacgtgactctcaattggaagagactaaggcacattacactaac
ctttatgtgaaaaacatcaactccgaaactactgacgaacaattccaagaattgtttgcc
aaatttggtccaattgtttctgcctctttggaaaaggatgctgatggaaaattgaagggt
ttcgggtttgttaactacgaaaagcatgaagacgctgtgaaagctgttgaagctttgaat
gactctgaactaaatggagaaaagttatacgttggtcgtgcccaaaagaagaatgaacgt
atgcatgtcttgaagaagcaatacgaagcttacagattggaaaaaatggccaagtaccaa
ggtgttaatttgtttgttaagaacttagatgacagcgttgatgacgaaaagttggaagaa
gaatttgctccatatggtactatcacttctgcaaaggttatgagaaccgaaaacggtaag
tctaagggttttggttttgtttgtttctcaactccagaggaagctactaaggccattaca
gaaaagaaccaacaaattgttgctggtaagccattatacgttgccattgctcaaagaaaa
gacgtaagacgttctcaattggctcaacaaatccaagccagaaatcaaatgagataccag
caagctactgctgccgctgccgccgccgctgccggtatgccaggtcaattcatgcctcca
atgttctatggtgttatgccaccaagaggtgttccattcaacggtccaaacccacaacaa
atgaacccaatgggcggtatgccaaagaacggcatgccacctcaatttagaaatggtccg
gtttacggcgtccccccacaaggtggtttcccaagaaatgccaacgataacaaccaattt
tatcaacaaaagcaaagacaagctttgggtgaacaattatacaagaaggtttctgctaag
acttcaaatgaagaagcagctggtaaaattactggtatgattttggatttgccacctcaa
gaggtcttcccattgttggaaagtgatgaattgttcgaacaacactacaaagaagcttct
gctgcctatgagtctttcaaaaaggagcaagaacaacaaactgagcaagcttaa

Protein sequence

>856912 : length: 577
MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSP
IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL
RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK
EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA
KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER
MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK
SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ
QATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNGMPPQFRNGP
VYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQ
EVFPLLESDELFEQHYKEASAAYESFKKEQEQQTEQA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min