Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

1056, CEL

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

BAL|BSDL|BSSL|CELL|CEase|FAP|FAPP|LIPA|MODY8;
CEL;
carboxyl ester lipase (bile salt-stimulated lipase);
OTTHUMP00000022450|bile salt-dependent lipase, oncofetal isoform|bile salt-stimulated carboxyl ester lipase|bile salt-stimulated lipase|bile-salt-activated lipase|carboxyl ester hydrolase|carboxyl ester lipase|cholesterol esterase|fetoacinar pancreatic protein|lysophospholipase, pancreatic|sterol esterase

Description

carboxyl ester lipase (bile salt-stimulated lipase)

Xrefs

HGNC:1848| MIM:114840| Ensembl:ENSG00000170835| HPRD:07509

Chromosome

9 : 9q34.3

Links to iHOP

1056

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1056 155971 PMID: 17005819

Sequence Information

Nucleotide sequence

>1056 : length: 2271
atgctcaccatggggcgcctgcaactggttgtgttgggcctcacctgctgctgggcagtg
gcgagtgccgcgaagctgggcgccgtgtacacagaaggtgggttcgtggaaggcgtcaat
aagaagctcggcctcctgggtgactctgtggacatcttcaagggcatccccttcgcagct
cccaccaaggccctggaaaatcctcagccacatcctggctggcaagggaccctgaaggcc
aagaacttcaagaagagatgcctgcaggccaccatcacccaggacagcacctacggggat
gaagactgcctgtacctcaacatttgggtgccccagggcaggaagcaagtctcccgggac
ctgcccgttatgatctggatctatggaggcgccttcctcatggggtccggccatggggcc
aacttcctcaacaactacctgtatgacggcgaggagatcgccacacgcggaaacgtcatc
gtggtcaccttcaactaccgtgtcggcccccttgggttcctcagcactggggacgccaat
ctgccaggtaactatggccttcgggatcagcacatggccattgcttgggtgaagaggaat
atcgcggccttcgggggggaccccaacaacatcacgctcttcggggagtctgctggaggt
gccagcgtctctctgcagaccctctccccctacaacaagggcctcatccggcgagccatc
agccagagcggcgtggccctgagtccctgggtcatccagaaaaacccactcttctgggcc
aaaaaggtggctgagaaggtgggttgccctgtgggtgatgccgccaggatggcccagtgt
ctgaaggttactgatccccgagccctgacgctggcctataaggtgccgctggcaggcctg
gagtaccccatgctgcactatgtgggcttcgtccctgtcattgatggagacttcatcccc
gctgacccgatcaacctgtacgccaacgccgccgacatcgactatatagcaggcaccaac
aacatggacggccacatcttcgccagcatcgacatgcctgccatcaacaagggcaacaag
aaagtcacggaggaggacttctacaagctggtcagtgagttcacaatcaccaaggggctc
agaggcgccaagacgacctttgatgtctacaccgagtcctgggcccaggacccatcccag
gagaataagaagaagactgtggtggactttgagaccgatgtcctcttcctggtgcccacc
gagattgccctagcccagcacagagccaatgccaagagtgccaagacctacgcctacctg
ttttcccatccctctcggatgcccgtctaccccaaatgggtgggggccgaccatgcagat
gacattcagtacgttttcgggaagcccttcgccacccccacgggctaccggccccaagac
aggacagtctctaaggccatgatcgcctactggaccaactttgccaaaacaggggacccc
aacatgggcgactcggctgtgcccacacactgggaaccctacactacggaaaacagcggc
tacctggagatcaccaagaagatgggcagcagctccatgaagcggagcctgagaaccaac
ttcctgcgctactggaccctcacctatctggcgctgcccacagtgaccgaccaggaggcc
acccctgtgccccccacaggggactccgaggccactcccgtgccccccacgggtgactcc
gagaccgcccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggt
gactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccgccc
acgggtgactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtg
ccgcccacgggtgactccggggccccccccgtgccgcccacgggtgactccggggccccc
cccgtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgacgccggg
cccccccccgtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgac
tccggggccccccccgtgacccccacgggtgactccgagaccgcccccgtgccgcccacg
ggtgactccggggccccccctgtgccccccacgggtgactctgaggctgcccctgtgccc
cccacagatgactccaaggaagctcagatgcctgcagtcattaggttttag

Protein sequence

>1056 : length: 756
MLTMGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAA
PTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRD
LPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDAN
LPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAI
SQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGL
EYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNK
KVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPT
EIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQD
RTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTN
FLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTG
DSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAP
PVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPT
GDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF



Basic Information

Gene ID

3988, LIPA

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

CESD|LAL;
LIPA;
lipase A, lysosomal acid, cholesterol esterase;
OTTHUMP00000020066|OTTHUMP00000020068|OTTHUMP00000059643|cholesterol ester hydrolase|lipase A|lysosomal acid lipase|sterol esterase

Description

lipase A, lysosomal acid, cholesterol esterase

Xrefs

HGNC:6617| MIM:278000| Ensembl:ENSG00000107798| HPRD:02044

Chromosome

10 : 10q23.2-q23.3

Links to iHOP

3988

Sequence Information

Nucleotide sequence

>3988 : length: 1200
atgaaaatgcggttcttggggttggtggtctgtttggttctctggaccctgcattctgag
gggtctggagggaaactgacagctgtggatcctgaaacaaacatgaatgtgagtgaaatt
atctcttactggggattccctagtgaggaatacctagttgagacagaagatggatatatt
ctgtgccttaaccgaattcctcatgggaggaagaaccattctgacaaaggtcccaaacca
gttgtcttcctgcaacatggcttgctggcagattctagtaactgggtcacaaaccttgcc
aacagcagcctgggcttcattcttgctgatgctggttttgacgtgtggatgggcaacagc
agaggaaatacctggtctcggaaacataagacactctcagtttctcaggatgaattctgg
gctttcagttatgatgagatggcaaaatatgacctaccagcttccattaacttcattctg
aataaaactggccaagaacaagtgtattatgtgggtcattctcaaggcaccactataggt
tttatagcattttcacagatccctgagctggctaaaaggattaaaatgttttttgccctg
ggtcctgtggcttccgtcgccttctgtactagccctatggccaaattaggacgattacca
gatcatctcattaaggacttatttggagacaaagaatttcttccccagagtgcgtttttg
aagtggctgggtacccacgtttgcactcatgtcatactgaaggagctctgtggaaatctc
tgttttcttctgtgtggatttaatgagagaaatttaaatatgtctagagtggatgtatat
acaacacattctcctgctggaacttctgtgcaaaacatgttacactggagccaggctgtt
aaattccaaaagtttcaagcctttgactggggaagcagtgccaagaattattttcattac
aaccagagttatcctcccacatacaatgtgaaggacatgcttgtgccgactgcagtctgg
agcgggggtcacgactggcttgcagatgtctacgacgtcaatatcttactgactcagatc
accaacttggtgttccatgagagcattccggaatgggagcatcttgacttcatttggggc
ctggatgccccttggaggctttataataaaattattaatctaatgaggaaatatcagtga

Protein sequence

>3988 : length: 399
MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYI
LCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNS
RGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIG
FIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFL
KWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAV
KFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQI
TNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ



Basic Information

Gene ID

3990, LIPC

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

HDLCQ12|HL|HTGL|LIPH;
LIPC;
lipase, hepatic;
lipase C

Description

lipase, hepatic

Xrefs

HGNC:6619| MIM:151670| Ensembl:ENSG00000166035| HPRD:01058

Chromosome

15 : 15q21-q23

Links to iHOP

3990

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

3990 338 PMID: 9685400
3990 4035 PMID: 7721852

Sequence Information

Nucleotide sequence

>3990 : length: 1500
atggacacaagtcccctgtgtttctccattctgttggttttatgcatctttatccaatca
agtgcccttggacaaagcctgaaaccagagccatttggaagaagagctcaagctgttgaa
acaaacaaaacgctgcatgagatgaagaccagattcctgctctttggagaaaccaatcag
ggctgtcagattcgaatcaatcatccggacacgttacaggagtgcggcttcaactcctcc
ctgcctctggtgatgataatccacgggtggtcggtggacggcgtgctagaaaactggatc
tggcagatggtggccgcgctgaagtctcagccggcccagccagtgaacgtggggctggtg
gactggatcaccctggcccacgaccactacaccatcgccgtccgcaacacccgccttgtg
ggcaaggaggtcgcggctcttctccggtggctggaggaatctgtgcaactctctcgaagc
catgttcacctaattgggtacagcctgggtgcacacgtgtcaggatttgccggcagttcc
atcggtggaacgcacaagattgggagaatcacagggctggatgccgcgggacctttgttt
gagggaagtgcccccagcaatcgtctttctccagatgatgccaattttgtggatgccatt
catacctttacccgggagcacatgggcctgagcgtgggcatcaaacagcccataggacac
tatgacttctatcccaacgggggctccttccagcctggctgccacttcctagagctctac
agacatattgcccagcacggcttcaatgccatcacccagaccataaaatgctcccacgag
cgatcggtgcaccttttcatcgactccttgctgcacgccggcacgcagagcatggcctac
ccgtgtggtgacatgaacagcttcagccagggcctgtgcctgagctgcaagaagggccgc
tgcaacacgctgggctaccacgtccgccaggagccgcggagcaagagcaagaggctcttc
ctcgtaacgcgagcccagtcccccttcaaagtttatcattaccagttcaagatccagttc
atcaaccaaactgagacaccaatacaaacaacttttaccatgtcactactcggaacaaaa
gagaaaatgcagaaaattcccatcactctgggcaaaggaattgctagtaataaaacgtat
tcctttcttatcacgctggatgtggatatcggcgagctgatcatgatcaagttcaagtgg
gaaaacagtgcagtgtgggccaatgtctgggacacggtccagaccatcatcccatggagc
acagggccgcgccactcaggcctcgttctgaagacgatcagagtcaaagcaggagaaacc
cagcaaagaatgacattttgttcagaaaacacagatgacctactacttcgcccaacccag
gaaaaaatcttcgtgaaatgtgaaataaagtctaaaacatcaaagcgaaagatcagatga

Protein sequence

>3990 : length: 499
MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQ
GCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLV
DWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSS
IGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGH
YDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQFKIQF
INQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW
ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQ
EKIFVKCEIKSKTSKRKIR



Basic Information

Gene ID

5406, PNLIP

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

PL;
PNLIP;
pancreatic lipase;
OTTHUMP00000020564|pancreatic triacylglycerol lipase|triacylglycerol acylhydrolase

Description

pancreatic lipase

Xrefs

HGNC:9155| MIM:246600| Ensembl:ENSG00000175535| HPRD:02005

Chromosome

10 : 10q26.1

Links to iHOP

5406

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5406 1208 PMID: 16189514

Sequence Information

Nucleotide sequence

>5406 : length: 1398
atgctgccactttggactctttcactgctgctgggagcagtagcaggaaaagaagtttgc
tacgaaagactcggctgcttcagtgatgactccccatggtcaggaattacggaaagaccc
ctccatatattgccttggtctccaaaagatgtcaacacccgcttcctcctatatactaat
gagaacccaaacaactttcaagaagttgccgcagattcatcaagcatcagtggctccaat
ttcaaaacaaatagaaaaactcgctttattattcatggattcatagacaagggagaagaa
aactggctggccaatgtgtgcaagaatctgttcaaggtggaaagtgtgaactgtatctgt
gtggactggaaaggtggctcccgaactggatacacacaagcctcgcagaacatcaggatc
gtgggagcagaagtggcatattttgttgaatttcttcagtcggcgttcggttactcacct
tccaacgtgcatgtcattggccacagcctgggtgcccacgctgctggggaggctggaagg
agaaccaatgggaccattggacgcatcacagggttggacccagcagaaccttgctttcag
ggcacacctgaattagtccgattggaccccagcgatgccaaatttgtggatgtaattcac
acggatggtgcccccatagtccccaatttggggtttggaatgagccaagtcgtgggccac
ctagatttctttccaaatggaggagtggaaatgcctggatgtaaaaagaacattctctct
cagattgtggacatagacggaatctgggaagggactcgagactttgcggcctgtaatcac
ttaagaagctacaaatattacactgatagcatcgtcaaccctgatggctttgctggattc
ccctgtgcctcttacaacgtcttcactgcaaacaagtgtttcccttgtccaagtggaggc
tgcccacagatgggtcactatgctgatagatatcctgggaaaacaaatgatgtgggccag
aaattttatctagacactggtgatgccagtaattttgcacgttggaggtataaggtatct
gtcacactgtctggaaaaaaggttacaggacacatactagtttctttgttcggaaataaa
ggaaactctaagcagtatgaaattttcaagggcactctcaaaccagatagtactcattcc
aatgaatttgactcagatgtggatgttggggacttgcagatggttaaatttatttggtat
aacaatgtgatcaacccaactttacctagagtgggagcatccaagattatagtggagaca
aatgttggaaaacagttcaacttctgtagtccagaaaccgtcagggaggaagttctgctc
accctcacaccgtgttag

Protein sequence

>5406 : length: 465
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC



Basic Information

Gene ID

5407, PNLIPRP1

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

PLRP1;
PNLIPRP1;
pancreatic lipase-related protein 1;
OTTHUMP00000020567

Description

pancreatic lipase-related protein 1

Xrefs

HGNC:9156| MIM:604422| Ensembl:ENSG00000187021| HPRD:05109

Chromosome

10 : 10q25.3

Links to iHOP

5407

Sequence Information

Nucleotide sequence

>5407 : length: 1404
atgctgatcttctggacaatcacacttttcctgctgggagcagccaaaggaaaagaagtt
tgctatgaggacctcgggtgcttttctgacactgagccctggggcgggacagcaatcagg
cccctgaaaattctcccctggagccctgagaagatcggcacccgcttcctgctgtacacc
aatgaaaacccaaacaactttcaaattctcctcctctctgatccatcaacaattgaggca
tcaaattttcaaatggacagaaagacccggttcatcatccatggcttcatagacaaagga
gatgagagctgggtgacagacatgtgcaagaaactgttcgaggtggaggaggtgaactgc
atctgcgtggactggaagaagggctcccaagccacctacacacaggctgccaacaacgtg
cgagtggtgggcgcccaggtggcccagatgctcgacatcctcttgacagagtatagctac
cccccttccaaagttcacctcattggccacagcctgggagcccacgtggctggagaggca
ggaagcaagactccaggcctgagcaggattacagggttggatcctgtagaagcaagtttc
gagagtactcctgaagaggtgcgacttgatccctctgatgctgactttgttgatgtgatt
cacacggatgcagctcccctgatcccattcttgggttttggaacgaaccaacagatgggt
catcttgacttcttccccaatggaggagagagcatgccgggatgcaagaagaatgccctg
tctcagatcgtggatctagatggcatctgggcgggaacccgggactttgtggcttgcaat
cacctaagaagctacaagtattacttggaaagcatcctcaatcccgatgggtttgctgca
tatccctgcacttcctacaagtcctttgagtctgacaagtgcttcccgtgtccagatcaa
ggatgcccacagatgggtcactatgctgataaatttgctggcaggacaagtgaagagcag
cagaaattcttcttgaacacaggagaggctagcaatttcgctcgctggagatatggggtt
tccatcacactgtctggaagaacagccactggtcagatcaaagttgctttgtttggaaat
aagggaaacactcaccagtacagcatcttcagggggattctcaaaccaggctcaacccat
tcctatgagtttgatgcaaagctggatgttggaacaattgagaaagtcaagtttctttgg
aataacaatgtgataaatccaaccctccccaaagtgggtgccaccaagatcactgtgcaa
aagggagaagagaagacagtgtacaacttctgtagcgaagacacagtgcgggaagacacg
ctgctcaccctcacgccctgctaa

Protein sequence

>5407 : length: 467
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC



Basic Information

Gene ID

5408, PNLIPRP2

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

PLRP2;
PNLIPRP2;
pancreatic lipase-related protein 2;
-

Description

pancreatic lipase-related protein 2

Xrefs

HGNC:9157| MIM:604423| HPRD:05110

Chromosome

10 : 10q25.3

Links to iHOP

5408

Sequence Information

Nucleotide sequence

>5408 : length: 1413
atgatgctgcccccttggaccctcggccttctcctgctggccacagtcagaggaaaagag
gtctgctacggacaacttggctgcttttctgatgaaaaaccatgggcaggaacccttcag
cgacctgtaaaattacttccctggtcccccgaggacattgacacccgctttcttctgtac
acaaatgaaaatccaaacaacttccaactaatcactggcacggaaccagacaccattgag
gcttcaaacttccaactggaccgcaagacacgcttcatcatccatggcttcttagacaag
gcggaggacagctggccatcggacatgtgcaagaaaatgtttgaagtggagaaggtgaac
tgcatctgtgtggactggaggcacgggtcccgggcaatgtacacccaagccgtgcaaaac
attcgggttgttggggcggagacagctttcttaatacaagcactgtcgacgcagctaggg
tacagccttgaggacgtgcatgtcatcggccacagcctgggcgcgcacacggccgcggag
gcgggcaggaggctggggggccgcgtgggcaggatcacagggctggatccagcagggccg
tgcttccaggatgaacctgaggaggttcggttggatccatctgacgccgtgtttgtggat
gtgattcacacagattcttctcccatagttccttccctaggtttcggaatgagccaaaag
gtgggccatctggatttctttccaaatggaggaaaggaaatgcccggatgtaagaaaaat
gtcctttcaaccattactgatattgatggaatatgggaaggaattggtggctttgtgtct
tgcaatcacctaagaagcttcgagtattactcaagcagcgtcctcaaccctgatggcttc
ctgggctatccctgtgcctcctacgatgagtttcaggagagtaagtgtttcccttgtcca
gctgaaggatgccccaaaatggggcactatgctgaccaatttaaggggaaaacaagtgct
gtggaacaaacctttttcctgaacacaggagagagtggtaactttactagttggagatat
aaggtatcagtcacactttctggaaaagagaaagtgaatgggtacatcaggattgctttg
tatggaagtaatgaaaactcaaaacaatatgagattttcaaaggatccctcaaaccagat
gcaagtcacacgtgtgctattgatgtggattttaatgttggaaaaatacagaaagttaaa
ttcctctggaacaaacgtgggataaatctatctgagcccaaactgggggcttcccaaatc
acagtgcaaagtggtgaagatgggactgagtataatttttgtagcagcgacactgtggaa
gaaaacgtcttgcaatctctttacccttgttaa

Protein sequence

>5408 : length: 470
MMLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLY
TNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVN
CICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAE
AGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQK
VGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGF
LGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRY
KVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVK
FLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC



Basic Information

Gene ID

80339, PNPLA3

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

RP4-796I17.1;
ADPN|C22orf20|iPLA(2)epsilon;
PNPLA3;
patatin-like phospholipase domain containing 3;
OTTHUMP00000028602|adiponutrin

Description

patatin-like phospholipase domain containing 3

Xrefs

HGNC:18590| MIM:609567| Ensembl:ENSG00000100344| HPRD:12430

Chromosome

22 : 22q13.31

Links to iHOP

80339

Sequence Information

Nucleotide sequence

>80339 : length: 1446
atgtacgacgcagagcgcggctggagcttgtccttcgcgggctgcggcttcctgggcttc
taccacgtcggggcgacccgctgcctgagcgagcacgccccgcacctcctccgcgacgcg
cgcatgttgttcggcgcttcggccggggcgttgcactgcgtcggcgtcctctccggtatc
ccgctggagcagactctgcaggtcctctcagatcttgtgcggaaggccaggagtcggaac
attggcatcttccatccatccttcaacttaagcaagttcctccgacagggtctctgcaaa
tgcctcccggccaatgtccaccagctcatctccggcaaaataggcatctctcttaccaga
gtgtctgatggggaaaacgttctggtgtctgactttcggtccaaagacgaagtcgtggat
gccttggtatgttcctgcttcatccccttctacagtggccttatccctccttccttcaga
ggcgtgcgatatgtggatggaggagtgagtgacaacgtacccttcattgatgccaaaaca
accatcaccgtgtcccccttctatggggagtacgacatctgccctaaagtcaagtccacg
aactttcttcatgtggacatcaccaagctcagtctacgcctctgcacagggaacctctac
cttctctcgagagcttttgtccccccggatctcaaggtgctgggagagatatgccttcga
ggatatttggatgcattcaggttcttggaagagaagggcatctgcaacaggccccagcca
ggcctgaagtcatcctcagaagggatggatcctgaggtcgccatgcccagctgggcaaac
atgagtctggattcttccccggagtcggctgccttggctgtgaggctggagggagatgag
ctgctagaccacctgcgtctcagcatcctgccctgggatgagagcatcctggacaccctc
tcgcccaggctcgctacagcactgagtgaagaaatgaaagacaaaggtggatacatgagc
aagatttgcaacttgctacccattaggataatgtcttatgtaatgctgccctgtaccctg
cctgtggaatctgccattgcgattgtccagagactggtgacatggcttccagatatgccc
gacgatgtcctgtggttgcagtgggtgacctcacaggtgttcactcgagtgctgatgtgt
ctgctccccgcctccaggtcccaaatgccagtgagcagccaacaggcctccccatgcaca
cctgagcaggactggccctgctggactccctgctcccccaagggctgtccagcagagacc
aaagcagaggccaccccgcggtccatcctcaggtccagcctgaacttcttcttgggcaat
aaagtacctgctggtgctgaggggctctccacctttcccagtttttcactagagaagagt
ctgtga

Protein sequence

>80339 : length: 481
MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGI
PLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTR
VSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKT
TITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLR
GYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDE
LLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTL
PVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT
PEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
L



Basic Information

Gene ID

8513, LIPF

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

GL|HGL|HLAL|MGC138477|MGC142271;
LIPF;
lipase, gastric;
OTTHUMP00000020038|gastric lipase|gastric triacylglycerol lipase

Description

lipase, gastric

Xrefs

HGNC:6622| MIM:601980| Ensembl:ENSG00000182333| HPRD:09063

Chromosome

10 : 10q23.31

Links to iHOP

8513

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

8513 1208 PMID: 11099794

Sequence Information

Nucleotide sequence

>8513 : length: 1197
atgtggctgcttttaacaatggcaagtttgatatctgtactggggactacacatggtttg
tttggaaaattacatcctggaagccctgaagtgactatgaacattagtcagatgattact
tattggggatacccaaatgaagaatatgaagttgtgactgaagatggttatattcttgaa
gtcaatagaattccttatgggaagaaaaattcagggaatacaggccagagacctgttgtg
tttttgcagcatggtttgcttgcatcagccacaaactggatttccaacctgccgaacaac
agccttgccttcattctggcagatgctggttatgatgtgtggctgggcaacagcagagga
aacacctgggccagaagaaacttgtactattcaccagattcagttgaattctgggctttc
agctttgatgaaatggctaaatatgaccttccagccacaatcgacttcattgtaaagaaa
actggacagaagcagctacactatgttggccattcccagggcaccaccattggttttatt
gccttttccaccaatcccagcctggctaaaagaatcaaaaccttctatgctctagctcct
gttgccactgtgaagtatacaaaaagccttataaacaaacttagatttgttcctcaatcc
ctcttcaagtttatatttggtgacaaaatattctacccacacaacttctttgatcaattt
cttgctactgaagtgtgctcccgtgagatgctgaatctcctttgcagcaatgccttattt
ataatttgtggatttgacagtaagaactttaacacgagtcgcttggatgtgtatctatca
cataatccagcaggaacttctgttcaaaacatgttccattggacccaggctgttaagtct
gggaaattccaagcttatgactggggaagcccagttcagaataggatgcactatgatcag
tcccaacctccctactacaatgtgacagccatgaatgtaccaattgcagtgtggaacggt
ggcaaggacctgttggctgacccccaagatgttggccttttgcttccaaaactccccaat
cttatttaccacaaggagattcctttttacaatcacttggactttatctgggcaatggat
gcccctcaagaagtttacaatgacattgtttctatgatatcagaagataaaaagtag

Protein sequence

>8513 : length: 398
MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILE
VNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRG
NTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFI
AFSTNPSLAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQF
LATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPN
LIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK



Basic Information

Gene ID

9388, LIPG

Enzyme Number

3.1.1.3

RLRdb entry

RL00163

Organisms

Human (9606)

Synonyms

EDL|EL|PRO719;
LIPG;
lipase, endothelial;
endothelial cell-derived lipase|endothelial lipase|lipoprotein lipase H

Description

lipase, endothelial

Xrefs

HGNC:6623| MIM:603684| Ensembl:ENSG00000101670| HPRD:04730

Chromosome

18 : 18q21.1

Links to iHOP

9388

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

9388 2175 PMID: 14499622

Sequence Information

Nucleotide sequence

>9388 : length: 1503
atgagcaactccgttcctctgctctgtttctggagcctctgctattgctttgctgcgggg
agccccgtaccttttggtccagagggacggctggaagataagctccacaaacccaaagct
acacagactgaggtcaaaccatctgtgaggtttaacctccgcacctccaaggacccagag
catgaaggatgctacctctccgtcggccacagccagcccttagaagactgcagtttcaac
atgacagctaaaacctttttcatcattcacggatggacgatgagcggtatctttgaaaac
tggctgcacaaactcgtgtcagccctgcacacaagagagaaagacgccaatgtagttgtg
gttgactggctccccctggcccaccagctttacacggatgcggtcaataataccagggtg
gtgggacacagcattgccaggatgctcgactggctgcaggagaaggacgatttttctctc
gggaatgtccacttgatcggctacagcctcggagcgcacgtggccgggtatgcaggcaac
ttcgtgaaaggaacggtgggccgaatcacaggtttggatcctgccgggcccatgtttgaa
ggggccgacatccacaagaggctctctccggacgatgcagattttgtggatgtcctccac
acctacacgcgttccttcggcttgagcattggtattcagatgcctgtgggccacattgac
atctaccccaatgggggtgacttccagccaggctgtggactcaacgatgtcttgggatca
attgcatatggaacaatcacagaggtggtaaaatgtgagcatgagcgagccgtccacctc
tttgttgactctctggtgaatcaggacaagccgagttttgccttccagtgcactgactcc
aatcgcttcaaaaaggggatctgtctgagctgccgcaagaaccgttgtaatagcattggc
tacaatgccaagaaaatgaggaacaagaggaacagcaaaatgtacctaaaaacccgggca
ggcatgcctttcagagtttaccattatcagatgaaaatccatgtcttcagttacaagaac
atgggagaaattgagcccaccttttacgtcaccctttatggcactaatgcagattcccag
actctgccactggaaatagtggagcggatcgagcagaatgccaccaacaccttcctggtc
tacaccgaggaggacttgggagacctcttgaagatccagctcacctgggagggggcctct
cagtcttggtacaacctgtggaaggagtttcgcagctacctgtctcaaccccgcaacccc
ggacgggagctgaatatcaggcgcatccgggtgaagtctggggaaacccagcggaaactg
acattttgtacagaagaccctgagaacaccagcatatccccaggccgggagctctggttt
cgcaagtgtcgggatggctggaggatgaaaaacgaaaccagtcccactgtggagcttccc
tga

Protein sequence

>9388 : length: 500
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min