Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

124, ADH1A

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH1;
ADH1A;
alcohol dehydrogenase 1A (class I), alpha polypeptide;
ADH, alpha subunit|alcohol dehydrogenase 1 (class I), alpha polypeptide|aldehyde reductase|class I alcohol dehydrogenase, alpha subunit

Description

alcohol dehydrogenase 1A (class I), alpha polypeptide

Xrefs

HGNC:249| MIM:103700| Ensembl:ENSG00000187758| HPRD:00063

Chromosome

4 : 4q21-q23

Links to iHOP

124

Sequence Information

Nucleotide sequence

>124 : length: 1128
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtggaggttgcacctcctaaggcccatgaagttcgtattaag
atggtggctgtaggaatctgtggcacagatgaccacgtggttagtggtaccatggtgacc
ccacttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccactcgctattcctcagtgtggaaaa
tgcagaatttgtaaaaacccggagagcaactactgcttgaaaaacgatgtaagcaatcct
caggggaccctgcaggatggcaccagcaggttcacctgcaggaggaagcccatccaccac
ttccttggcatcagcaccttctcacagtacacagtggtggatgaaaatgcagtagccaaa
attgatgcagcctcgcctctagagaaagtctgtctcattggctgtggattttcaactggt
tatgggtctgcagtcaatgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctattatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcatttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcatcgtaggggtacctcctgattcccaa
aacctctcaatgaaccctatgctgctactgactggacgtacctggaagggagctattctt
ggtggctttaaaagtaaagaatgtgtcccaaaacttgtggctgattttatggctaagaag
ttttcattggatgcattaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccattctgatgttttga

Protein sequence

>124 : length: 375
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNP
QGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTILMF



Basic Information

Gene ID

125, ADH1B

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH2|DKFZp686C06125;
ADH1B;
alcohol dehydrogenase 1B (class I), beta polypeptide;
ADH, beta subunit|alcohol dehydrogenase 2 (class I), beta polypeptide|alcohol dehydrogenase IB (class I), beta polypeptide|aldehyde reductase

Description

alcohol dehydrogenase 1B (class I), beta polypeptide

Xrefs

HGNC:250| MIM:103720| Ensembl:ENSG00000196616| HPRD:00065

Chromosome

4 : 4q21-q23

Links to iHOP

125

Sequence Information

Nucleotide sequence

>125 : length: 1128
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggaggtaaagaaa
cccttttccattgaggatgtggaggttgcacctcctaaggcttatgaagttcgcattaag
atggtggctgtaggaatctgtcacacagatgaccacgtggttagtggcaacctggtgacc
ccccttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagagtttgtaaaaacccggagagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgcctcattggctgtggattctcgactggt
tatgggtctgcagttaacgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctgttatgggctgtaaagcagctggagcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaagtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagcgtcatcgtaggggtacctcctgcttcccag
aacctctcaataaaccctatgctgctactgactggacgcacctggaagggggctgtttat
ggtggctttaagagtaaagaaggtatcccaaaacttgtggctgattttatggctaagaag
ttttcactggatgcgttaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccgtcctgacgttttga

Protein sequence

>125 : length: 375
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQ
NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTVLTF



Basic Information

Gene ID

126, ADH1C

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH3;
ADH1C;
alcohol dehydrogenase 1C (class I), gamma polypeptide;
ADH, gamma subunit|alcohol dehydrogenase 3 (class I), gamma polypeptide|aldehyde reductase|class I alcohol dehydrogenase, gamma subunit

Description

alcohol dehydrogenase 1C (class I), gamma polypeptide

Xrefs

HGNC:251| MIM:103730| HPRD:00066

Chromosome

4 : 4q21-q23

Links to iHOP

126

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

126 126 PMID: 11274460

Sequence Information

Nucleotide sequence

>126 : length: 1128
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtagaggttgcacctcctaaggctcatgaagttcgcattaag
atggtggctgcaggaatctgtcgttcagatgagcatgtggttagtggcaacctggtgacc
ccccttcctgtgattttaggccatgaggcagccggcatcgtggaaagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagaatttgtaaaaacccagaaagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagcgggaagcccatccaccac
ttcgtcggcgtcagcaccttctcccagtacacagtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgcctcattggctgtggattttcgactggt
tatgggtctgcagtcaaagttgccaaggtcaccccagggtctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgttgttatgggctgtaaagcagctggagcagccagaatc
attgctgtggacatcaacaaggacaaatttgcaaaggctaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaagtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcattgtaggggtacctcctgattcccag
aacctctcaataaaccctatgctgctactgactggacgcacgtggaaaggagctattttt
ggaggctttaagagtaaagaatctgtccccaaacttgtggctgactttatggctaagaag
ttttcactggatgcattaataacaaatattttaccttttgaaaaaataaatgaaggattt
gacctgcttcgctctggaaagagtatccgtaccgtcctgacgttttga

Protein sequence

>126 : length: 375
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
DLLRSGKSIRTVLTF



Basic Information

Gene ID

127, ADH4

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH-2;
ADH4;
alcohol dehydrogenase 4 (class II), pi polypeptide;
aldehyde reductase|class II alcohol dehydrogenase 4 pi subunit

Description

alcohol dehydrogenase 4 (class II), pi polypeptide

Xrefs

HGNC:252| MIM:103740| Ensembl:ENSG00000198099| HPRD:00068

Chromosome

4 : 4q21-q24|4q22

Links to iHOP

127

Sequence Information

Nucleotide sequence

>127 : length: 1143
atgggcaccaagggcaaagttattaaatgcaaagcagccatcgcctgggaagcaggcaag
cccctttgcattgaagaggttgaagtagctccccccaaggctcatgaagttcgcattcag
atcattgctacctccctgtgccatactgatgccactgttatcgattctaaatttgagggc
ctagctttcccagtgatcgttggccatgaggctgcaggtattgtggaaagtattgggcca
ggagtgaccaacgtcaaaccaggtgacaaagtaattccactttatgcacctctatgtaga
aaatgcaagttttgtctgagtccactcacaaatttgtgtgggaaaatcagtaatctcaaa
agtcctgctagtgatcaacaactaatggaagacaaaaccagcaggtttacctgcaaagga
aaaccagtttaccatttctttggaaccagtacattctctcagtacactgtggtgtcagat
atcaatcttgccaaaatagatgatgatgcaaatttagagagagtttgtctgcttggatgt
gggttttcaactggctatggggctgcaatcaacaatgccaaggtcacccctggttcgact
tgtgctgtctttggcctaggaggtgtgggtctttctgctgtaatgggttgtaaagcagca
ggagcttccagaatcataggtattgacatcaacagtgagaagtttgtgaaggctaaagcc
ctgggagccactgactgcctcaatcctagagacttacataaaccgatccaggaagttatc
attgaattgaccaagggaggtgtggattttgcccttgactgtgcaggtggatctgaaacc
atgaaagcagccctggactgtacaaccgcaggctggggatcatgtactttcattggagta
gctgctggtagcaaaggattgactatttttccagaggagctaataatcggccgtactata
aatggaacattctttggtggttggaaaagtgtagattctatcccaaagctggtcactgac
tataagaataagaaattcaatctggatgcactggtgacccataccctgccttttgacaaa
atcagtgaggcatttgacctaatgaaccaaggaaaaagcgtccgaacaatcctcatcttt
tga

Protein sequence

>127 : length: 380
MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEG
LAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLK
SPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGC
GFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKA
LGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGV
AAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDK
ISEAFDLMNQGKSVRTILIF



Basic Information

Gene ID

128, ADH5

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH-3|ADHX|FDH|GSNOR;
ADH5;
alcohol dehydrogenase 5 (class III), chi polypeptide;
alcohol dehydrogenase (class III), chi polypeptide|class III alcohol dehydrogenase 5|formaldehyde dehydrogenase|glutathione-dependent formaldehyde dehydrogenase

Description

alcohol dehydrogenase 5 (class III), chi polypeptide

Xrefs

HGNC:253| MIM:103710| HPRD:00064

Chromosome

4 : 4q21-q25

Links to iHOP

128

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

128 128 PMID: 12484756
128 128 PMID: 16189514
128 1107 PMID: 16169070

Sequence Information

Nucleotide sequence

>128 : length: 1125
atggcgaacgaggttatcaagtgcaaggctgcagttgcttgggaggctggaaagcctctc
tccatagaggagatagaggtggcacccccaaaggctcatgaagttcgaatcaagatcatt
gccactgcggtttgccacaccgatgcctataccctgagtggagctgatcctgagggttgt
tttccagtgatcttgggacatgaaggtgctggaattgtggaaagtgttggtgagggagtt
actaagctgaaggcgggtgacactgtcatcccactttacatcccacagtgtggagaatgc
aaattttgtctaaatcctaaaactaacctttgccagaagataagagtcactcaagggaaa
ggattaatgccagatggtaccagcagatttacttgcaaaggaaagacaattttgcattac
atgggaaccagcacattttctgaatacacagttgtggctgatatctctgttgctaaaata
gatcctttagcacctttggataaagtctgccttctaggttgtggcatttcaaccggttat
ggtgctgctgtgaacactgccaagttggagcctggctctgtttgtgccgtctttggtctg
ggaggagtcggattggcagttatcatgggctgtaaagtggctggtgcttcccggatcatt
ggtgtggacatcaataaagataaatttgcaagggccaaagagtttggagccactgaatgt
attaaccctcaggattttagtaaacccatccaggaagtgctcattgagatgaccgatgga
ggagtggactattcctttgaatgtattggtaatgtgaaggtcatgagagcagcacttgag
gcatgtcacaagggctggggcgtcagcgtcgtggttggagtagctgcttcaggtgaagaa
attgccactcgtccattccagctggtaacaggtcgcacatggaaaggcactgcctttgga
ggatggaagagtgtagaaagtgtcccaaagttggtgtctgaatatatgtccaaaaagata
aaagttgatgaatttgtgactcacaatctgtcttttgatgaaatcaacaaagcctttgaa
ctgatgcattctggaaagagcattcgaactgttgtaaagatttaa

Protein sequence

>128 : length: 374
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFE
LMHSGKSIRTVVKI



Basic Information

Gene ID

130, ADH6

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH-5;
ADH6;
alcohol dehydrogenase 6 (class V);
OTTHUMP00000161649|aldehyde reductase|class V alcohol dehydrogenase 6

Description

alcohol dehydrogenase 6 (class V)

Xrefs

HGNC:255| MIM:103735| Ensembl:ENSG00000172955| HPRD:00067

Chromosome

4 : 4q23

Links to iHOP

130

Sequence Information

Nucleotide sequence

>130 : length: 1107
atgagtactacaggccaagtcatcagatgcaaagcagccatactctggaagcctggtgca
ccattttctattgaagaggtagaagtggccccaccaaaggcaaaggaagttcgcataaag
gttgtggccaccggactgtgtggtacagagatgaaagtgttggggagtaaacacttggac
ctcttgtatcccaccatcttgggccatgaaggggctggaatcgttgagagtattggagaa
ggagtaagcacagtgaaaccaggtgacaaagttatcacactctttctgccacagtgtgga
gaatgtacctcttgcctgaattctgagggcaatttttgtatacaattcaaacagtcaaaa
acccaactgatgtctgatggtaccagcaggtttacctgcaagggaaaatcaatatatcac
tttggtaataccagcaccttctgtgaatacacagtgataaaggaaatctcagttgccaag
attgatgcagtcgctcctctagagaaagtatgcctaattagctgtggcttttccactggg
tttggtgctgcaatcaatactgccaaggtgactccaggttctacctgtgctgtgtttggc
ctgggaggagtcggcttgtctgttgtcatgggttgtaaagcagcaggagcagccaggatc
attggagtggatgtcaacaaggagaaatttaagaaggcacaggaattgggtgctactgag
tgcctcaaccctcaggacttaaagaaacccattcaagaagttttatttgatatgacagat
gctggtatagacttctgctttgaggccattggaaatctggacgttctggcagctgccctc
gcctcctgcaatgagagctatggggtctgtgtggttgttggggtgttgcctgccagtgtt
caactcaaaatcagtggccagttgttcttctcaggacgttctttgaagggttctgttttt
ggaggctggaagagcagacagcacatccctaaactggttgctgattatatggcagagaag
ttgaatctagatccactaattactcatactctgaatcttgataaaatcaatgaagcagtt
gaattaatgaaaactggaaaatggtaa

Protein sequence

>130 : length: 368
MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLD
LLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSK
TQLMSDGTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTG
FGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVNKEKFKKAQELGATE
CLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAV
ELMKTGKW



Basic Information

Gene ID

131, ADH7

Enzyme Number

1.1.1.1

RLRdb entry

RL00087

Organisms

Human (9606)

Synonyms

ADH-4;
ADH7;
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide;
alcohol dehydrogenase-7|class IV alcohol dehydrogenase 7 mu or sigma subunit|gastric alcohol dehydrogenase

Description

alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide

Xrefs

HGNC:256| MIM:600086| Ensembl:ENSG00000196344| HPRD:02515

Chromosome

4 : 4q23-q24

Links to iHOP

131

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

131 131 PMID: 9228021

Sequence Information

Nucleotide sequence

>131 : length: 1161
atgtttgcagaaatacagatccaagacaaagacaggatgggcactgctggaaaagttatt
aaatgcaaagcagctgtgctttgggagcagaagcaacccttctccattgaggaaatagaa
gttgccccaccaaagactaaagaagttcgcattaagattttggccacaggaatctgtcgc
acagatgaccatgtgataaaaggaacaatggtgtccaagtttccagtgattgtgggacat
gaggcaactgggattgtagagagcattggagaaggagtgactacagtgaaaccaggtgac
aaagtcatccctctctttctgccacaatgtagagaatgcaatgcttgtcgcaacccagat
ggcaacctttgcattaggagcgatattactggtcgtggagtactggctgatggcaccacc
agatttacatgcaagggcaaaccagtccaccacttcatgaacaccagtacatttaccgag
tacacagtggtggatgaatcttctgttgctaagattgatgatgcagctcctcctgagaaa
gtctgtttaattggctgtgggttttccactggatatggcgctgctgttaaaactggcaag
gtcaaacctggttccacttgcgtcgtctttggcctgggaggagttggcctgtcagtcatc
atgggctgtaagtcagctggtgcatctaggatcattgggattgacctcaacaaagacaaa
tttgagaaggccatggctgtaggtgccactgagtgtatcagtcccaaggactctaccaaa
cccatcagtgaggtgctgtcagaaatgacaggcaacaacgtgggatacacctttgaagtt
attgggcatcttgaaaccatgattgatgccctggcatcctgccacatgaactatgggacc
agcgtggttgtaggagttcctccatcagccaagatgctcacctatgacccgatgttgctc
ttcactggacgcacatggaagggatgtgtctttggaggtttgaaaagcagagatgatgtc
ccaaaactagtgactgagttcctggcaaagaaatttgacctggaccagttgataactcat
gttttaccatttaaaaaaatcagtgaaggatttgagctgctcaattcaggacaaagcatt
cgaacggtcctgacgttttga

Protein sequence

>131 : length: 386
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
VLPFKKISEGFELLNSGQSIRTVLTF



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min