Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

12763, Cmah

Enzyme Number

1.14.18.2

RLRdb entry

RL00530

Organisms

Mouse (10090)

Synonyms

RP23-80C18.1;
Cmah;
cytidine monophospho-N-acetylneuraminic acid hydroxylase;
CMP-NeuAc hydroxylase|OTTMUSP00000000644

Description

cytidine monophospho-N-acetylneuraminic acid hydroxylase

Xrefs

MGI:103227| Ensembl:ENSMUSG00000016756

Chromosome

13 : 13 A3.2

Links to iHOP

12763

Sequence Information

Nucleotide sequence

>12763 : length: 1734
atgatggacaggaaacagacagctgagaccctgctgaccctgtctcctgctgaagttgcc
aacctcaaggaagggatcaatttttttcgaaataagactactgggaaagagtacatttta
tacaaggagaaggaccatctaaaggcatgcaagaacctctgcaagcaccagggaggcctg
ttcatgaaagacatcgaggatttagatggaaggtccgttaaatgcacaaagcacaactgg
aagttagacgtgagcaccatgaaatatatcaaccctccagggagcttctgtcaagacgag
ctcgttattgaaatggatgaaaacaatgggctttccctggtagaactgaaccctcctaac
ccctgggactctgatcccaggtctcctgaagaattagcttttggggaagtacagataaca
tatctcactcatgcctgcatggacctcaagttgggagacaagcgaatggtatttgaccct
tggttaattggccctgcttttgcccgaggatggtggttgctacatgagcctccatctgac
tggttggagaggctgtgcaaagcagacctcatttatatcagccacatgcactcagaccac
ctgagctaccctaccctgaagcagctttcccagagacgaccagacattcccatttatgtt
ggcgacacagaaaggcctgtgttttggaacctggatcagagtggcgtcgggttaactaac
atcaacgtggttccatttggaatatggcaacaggtagacaaaagtctgcggttcatgatc
ttgatggacggcgttcatcctgagatggacacatgcattatcgtggagtacaaaggtcat
aaaatactcaacacagtggactgcaccagacccaatgggggaaggcttcctgagaaagtt
gctctaatgatgagtgatttcgcaggaggtgcatcaggctttccaatgactttcagtggt
ggaaaatttactgaggaatggaaagcccagttcattaaggctgaaagaagaaagcttctg
aattacaaagctcagctggtgaaggacctgcagccccgaatctactgtccgtttgctggg
tactttgtggagtctcacccatctgacaagtacattaaggaaacaaacaccaaaaatgac
ccaaatcagctcaacaatcttatcaggaaaaactctgacgtggtgacatggaccccacga
cctggcgctgtcctcgaccttggcaggatgctgaaggacccaacagacagcaagggcatt
gtggagcctccagaggggacaaagatttacaaggattcctgggactttggcccgtacctg
gagatcttgaattctgctgtcagagatgaaatcttctgtcattcatcctggattaaagag
tacttcacgtgggctggatttaagaattacaacctggtggtcaggatgattgaaacagat
gaagatttcagcccttttcctggagggtacgactatctggtggactttctagatttatcc
tttccgaaagaaagacccagccgggagcatccttatgaagaaatccatagccgggtggat
gtcatcaggtacgtggtgaagaacggcctgctgtgggatgatctgtatattggattccag
acccgattgctgcgggaccctgatatataccatcatctgttttggaatcattttcagata
aaactccctctaacaccacccaactggaagtcgttcctaatgcactgtgattag

Protein sequence

>12763 : length: 577
MMDRKQTAETLLTLSPAEVANLKEGINFFRNKTTGKEYILYKEKDHLKACKNLCKHQGGL
FMKDIEDLDGRSVKCTKHNWKLDVSTMKYINPPGSFCQDELVIEMDENNGLSLVELNPPN
PWDSDPRSPEELAFGEVQITYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLLHEPPSD
WLERLCKADLIYISHMHSDHLSYPTLKQLSQRRPDIPIYVGDTERPVFWNLDQSGVGLTN
INVVPFGIWQQVDKSLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPEKV
ALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKAERRKLLNYKAQLVKDLQPRIYCPFAG
YFVESHPSDKYIKETNTKNDPNQLNNLIRKNSDVVTWTPRPGAVLDLGRMLKDPTDSKGI
VEPPEGTKIYKDSWDFGPYLEILNSAVRDEIFCHSSWIKEYFTWAGFKNYNLVVRMIETD
EDFSPFPGGYDYLVDFLDLSFPKERPSREHPYEEIHSRVDVIRYVVKNGLLWDDLYIGFQ
TRLLRDPDIYHHLFWNHFQIKLPLTPPNWKSFLMHCD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min