Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

1375, CPT1B

Enzyme Number

2.3.1.21

RLRdb entry

RL00236

Organisms

Human (9606)

Synonyms

CPT1-M|KIAA1670|M-CPT1;
CPT1B;
carnitine palmitoyltransferase 1B (muscle);
CPTI, muscle|carnitine O-palmitoyltransferase I, mitochondrial muscle isoform|carnitine palmitoyltransferase 1A (muscle)|carnitine palmitoyltransferase 1B

Description

carnitine palmitoyltransferase 1B (muscle)

Xrefs

HGNC:2329| MIM:601987| Ensembl:ENSG00000205560| HPRD:09065

Chromosome

22 : 22q13.33

Links to iHOP

1375

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

1375 155971 PMID: 11095714

Sequence Information

Nucleotide sequence

>1375 : length: 2319
atggcggaagctcaccaggccgtggccttccagttcacggtgaccccagacggggtcgac
ttccggctcagtcgggaggccctgaaacacgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcatcatggcaacagtgggttcctccttctgcaacgtggacatctcc
ttggggctggtcagttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctgctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtatccgccttctatcc
agccggcaccctatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagttgctggccaaagaattccaggacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcaagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactattatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacatcatccacgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactgggc
atagtgcctatgtgctcctaccagatggagaggatgttcaacaccactcggatcccgggc
aaggacacagatgtgctacagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggcgcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaataaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggaatcctactcctatgaccccgaagatgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactctcatt
tccttcaagaatggccagttgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
accgggcactgcctgggcaaaccgaaccctgcgctcgcacctcctacacggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgttg
gcagacgacgtggagttgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccctgatgcctttgtgcagatcgcgctgcagctggctcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagcgagtccacagcctttgtgcaggccatgatg
gaggggtcccacacaaaagcagacctgcgagatctcttccagaaggctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctaggagtcagctctcctttccttgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccgcatgttcgacccagag
cagcaccccaatcacctgggcgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgattgcaggcgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaacgcccagcgctttggaaaccacatccgcaaagccctgctggac
attgctgatcttttccaagttcccaaggcctacagctga

Protein sequence

>1375 : length: 772
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min